KEGG   Encephalitozoon cuniculi: ECU08_0410Help
Entry
ECU08_0410        CDS       T00105                                 

Definition
HISTONE H2B
Orthology
K11252  
histone H2B
Organism
ecu  Encephalitozoon cuniculi
Brite
Exosome [BR:ecu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ECU08_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII:complement(51850..52242)
Genome map
AA seq 130 aa AA seqDB search
MAKSARHVTGKAPSSLDAHDRKKSKKKSSSMCVGSMFKSAVKRISREVSPDNNIMLTSNS
IQVLCGISYDFVDTVADLAGELARKVGKQTVGSDDIISAFEILLKGELRKLAIREVHNAL
SKSQAKSRGK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtctgcacggcatgttacaggtaaggcaccatcgtctctggatgcacacgat
aggaagaagtccaagaagaagtcgtcgtccatgtgtgtgggcagcatgttcaagtctgca
gtcaagcgtatttcccgggaggtcagtccagacaacaacatcatgctgacaagcaattcc
atccaggttctttgcggaatctcatacgactttgttgatacagttgccgatcttgctggt
gagctagcaaggaaggttgggaagcagacggtggggtctgacgacatcataagtgcattt
gagatcttactcaagggagagctgcgaaaacttgccatcagagaggtccacaacgccctt
tccaaaagccaagctaagtctcgtggaaaataa

DBGET integrated database retrieval system