KEGG   Encephalitozoon cuniculi: ECU08_1090Help
Entry
ECU08_1090        CDS       T00105                                 

Definition
similarity to HYPOTHETICAL PROTEIN YB36_METJA
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ecu  Encephalitozoon cuniculi
Brite
Enzymes [BR:ecu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ECU08_1090
Transfer RNA biogenesis [BR:ecu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    ECU08_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII:complement(122755..124596)
Genome map
AA seq 613 aa AA seqDB search
MCLGIEKPASSGLKIKFKISWLSRVPIRHCLASLAGPARSFPKELIRPSVSPRMSDFLKA
CNEISSEIVELYKQEKRIDVSAIKSRVCRKYRLGCTPRIVDIISFIPPEHGRLIEQLRAK
PVRTASGVAVVAVMCKPHRCPHIALTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIR
SRYDPFEQARERLRQLKALGHNTDKVEYIIMGGTFMSLPESYRDRFISRLHDALSGHTSP
TVEEAIRVGAEGRLKCVGITIETRPDFCVRPHLSKMLGYGCTRIEVGVQSVYEDVARDTN
RGHTVESVCESFALAKDAGFKIVAHMMPNLPNVPMKRDLAQFREYFDNPGFRSDGLKIYP
TLVIKGTGLFELWKNNKYRNYSPDELIDLLARILSLVPPWMRIYRVQRDIPMTLVSSGVE
HGNIRELALARMKDYRTRCRDIRTREVGIRNIHENILPEEVELVRRDYVANKGWETFLSY
EDVKQDILIGLLRLRKCSVDTFRTELRGLGLQPAANEGSLEADGHHPAVVNEHSSIIREL
HVYGSAAAISKSDGTKYQHQGYGTLLIAEAERIARDEHKSAKIAIISGVGTRNYYARFGY
VLEGPYMVKSLTG
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttaggtatagagaagcctgcatcttcagggctcaaaatcaagttcaaaatatca
tggctaagccgggtgcctatcagacattgcttggcatctctagcaggcccagctcgttct
tttcccaaggaattaattcggccttcggtctccccaagaatgtccgacttcctcaaggca
tgcaacgagatttcgagcgagatagtcgagctctacaagcaggagaaaaggatagacgtg
agtgcgatcaagtcgagggtatgcaggaagtacaggcttggatgcactccacggattgtg
gacatcatttcgttcattccgcccgagcacggacgtctgattgagcagctcagggcgaag
cctgtcagaactgcgtctggggttgctgttgttgctgtgatgtgcaagccccacagatgt
ccacacatcgcactgaccggaaacatatgcgtgtactgcccgggtggccccgactccgac
tttgagtactccactcaatcatacacgggatacgagccgacgagcatgagggcaataaga
agcaggtacgatccatttgagcaggcaagagaaaggctccggcagctcaaggcgcttggg
cacaacacagacaaggtggagtacataataatggggggaacatttatgtctctacccgag
tcgtacagagacagattcatctcaaggctgcacgatgctcttagcgggcacacatcgccg
actgtcgaagaagccatacgggttggggcagaagggcgcctgaagtgtgttggaataaca
atagagacaaggccagacttctgcgtgcgccctcatctcagcaaaatgctaggatatgga
tgcacaagaatcgaggtaggcgtccagagtgtatacgaggatgttgccagagacaccaac
agagggcacacggttgagagtgtctgcgaatcctttgcacttgcgaaggacgcagggttc
aagatagttgctcacatgatgcccaatcttccgaatgttcccatgaaaagagaccttgca
cagtttcgagagtacttcgacaaccccgggttcagaagcgacggactgaagatatatccc
acgcttgtgatcaagggcacagggctgtttgagctgtggaaaaacaacaagtacaggaac
tactccccggacgagctgattgatcttcttgcaaggattctttcacttgtgccgccatgg
atgaggatatacagggtgcagagggacatcccgatgacgctggtgagctctggcgtggag
cacggcaacataagagagctggcgctggctagaatgaaagactacaggacacgctgcaga
gacattcgaaccagagaggttgggatcaggaatatccacgagaacatcctgcctgaagag
gtcgagctggtgagaagagactatgtggcaaacaagggctgggagacgtttcttagctat
gaagacgtgaagcaagacattctgatagggctgctgaggctgcgcaagtgcagtgtggac
acgtttcggaccgagctaaggggcctaggcctgcaacctgcagcgaatgaaggtagcctc
gaggcagatggacatcatcctgctgtggtcaatgagcattcgtccataataagagagctt
catgtgtacggaagcgccgcagccataagcaaaagtgatggcacgaagtatcagcaccag
gggtacggcacactcctgattgccgaggctgagcggattgcaagggacgagcacaagtca
gcaaagatcgcaataatctccggggttggaaccagaaactactatgccaggtttgggtat
gtcttggaaggcccgtatatggttaaaagcctcacgggctga

DBGET integrated database retrieval system