KEGG   Encephalitozoon cuniculi: ECU10_0660Help
Entry
ECU10_0660        CDS       T00105                                 

Definition
HIV1-TAT INTERACTING PROTEIN 60KDa HOMOLOG (SAS/MOZ FAMILY)
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ecu  Encephalitozoon cuniculi
Brite
Enzymes [BR:ecu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ECU10_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X:complement(89344..90477)
Genome map
AA seq 377 aa AA seqDB search
MRLEDVCVGFKVPVRKAVDGGEEVFKAEILGKRAGKSGLEFYVHYVELNRRLDEWIDGSM
IDLGDPAQIEIPKKKKTEKTKSEKSERVSEKEGEQRDEEPKLERPPQDEEFKMKNVKKIM
LRNYLVDAWYFSPYPKAVAESDIVYICEFCLYYFSAVDSLVLHARQCKLRHPPGREIYRD
GVLSFFECDGHIQKNYCRNLSLLSKLFLDHKSLYYDIDVFMFYVLCRLEDNGYQIVGYFS
KEKMSEQGYNLACILTLPFEQRKGYGKILIDFSYLLSRRENVVSGPEKPLSDLGLLSYRA
YWMEVIVEYLSKHDKASISEISRETYISEDDVIGTLCAYKMLRMEGNEFIFTYAEDQLHK
ALRSRSRSVNAALLKLG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgaggatgtttgtgtgggattcaaagttcccgtcaggaaggccgtagatgga
ggcgaggaggtattcaaagcagagattctggggaaaagagccggcaagtctggactggag
ttctatgtacactatgtagaactgaacaggcggctcgatgagtggatcgacggatcgatg
atcgacttaggcgaccctgcccagatagaaattccaaagaagaagaagacagaaaagaca
aagagtgagaagtcggaaagggtctcagagaaggagggtgagcagagggacgaggagcca
aagctagaaaggccgccgcaggacgaggagttcaaaatgaagaatgttaagaagatcatg
ctccgcaactatcttgtggatgcctggtacttctcaccatacccaaaggcagtagcagag
agtgacattgtttatatatgcgaattctgtttgtactacttcagtgcagtggacagcctg
gttttacatgctaggcagtgcaagctccggcatcctcccggaagggagatatatcgggac
ggagtcctaagcttctttgagtgtgacgggcatatccagaagaactactgcagaaacctg
tcgctactatcaaagctatttctggaccataagtcactctactacgacatagacgtgttt
atgttttatgtgctttgcaggctggaggacaacgggtaccagatagtgggatacttctcg
aaggagaagatgtctgagcaaggatacaaccttgcatgcatcctgactctcccctttgag
caaaggaaggggtatggaaagattctcatagacttctcctacctgctcagcagaagagaa
aacgtggtctccgggccggaaaagcctctgagcgatcttgggcttctcagctatagagca
tactggatggaggtgattgtggaatatctttcaaagcacgacaaggcaagcattagcgag
atttcccgggaaacctacatatccgaggacgatgtgatagggactctgtgtgcatacaag
atgctgaggatggagggaaacgagtttattttcacatacgccgaggaccagctgcacaag
gccctgagatccaggagcaggagtgtaaatgccgccctgcttaagctaggctga

DBGET integrated database retrieval system