KEGG   Encephalitozoon cuniculi: ECU10_1430Help
Entry
ECU10_1430        CDS       T00105                                 

Definition
TRANSCRIPTIONAL ACTIVATOR
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ecu  Encephalitozoon cuniculi
Brite
Enzymes [BR:ecu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ECU10_1430
Transcription machinery [BR:ecu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     ECU10_1430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X:complement(202229..203419)
Genome map
AA seq 396 aa AA seqDB search
MDFFGLRRSQARRDEKAMHEKFRNRELRAVVVSSSSPGADKMLLLGIKCLFQKQLSRMPK
EYILRQVFDTKHVNMALVNSAEEIVGGICYRPFFERNFVEIVFLAVDYDFQVKGVGGFMM
DLLKEVVKEEAGDCSWKSADSLLGIYEHRGRTIDDLDPLLNRTLENSPLPLYLVTYADNF
AIGYFRKQGFSTDVRFGGWIGFIKDYEGGTVVECCVSWEINYLKKQEIIESMRRKLFEEM
KGINNYHITHKIEDYSRIKEIGDIPGVSGVECIVEEDRGMRLQARFISYLISDLQSNAHA
WPFLRPVDPAEVPDYYKCIAKPMDLSTMVLKLRNNEYGCIEAFVADVHLMVNNCFEYNGR
DTQYYKCAQALLDHFNKKLEFYRHVVGRLSTKRGAD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggatttttttgggctgagaaggagccaagcccggagagacgagaaggcgatgcatgag
aagtttaggaacagggagctgagggcggttgttgtgtcgtcctcaagtccaggggcagac
aagatgcttctccttggaatcaaatgcttatttcagaagcagctgtctagaatgcccaag
gaatacatcctcagacaagtgtttgacacaaagcatgtcaacatggccctggtaaactcc
gcagaagagattgtaggagggatatgttataggccgttctttgagaggaactttgtagag
atcgtgtttctggctgtcgactatgacttccaggtgaagggcgtcgggggatttatgatg
gacctgctcaaggaagttgttaaggaggaggctggagactgtagctggaagtcggctgac
agtctgcttgggatttatgagcacaggggcagaaccattgacgacctcgatccgcttctg
aacaggaccctggagaatagtcccctgcctctttacttggtgacatatgcagacaacttt
gcgataggatacttcagaaagcaggggttttcgactgatgtgagatttggcgggtggatt
gggtttatcaaggactacgagggaggaactgtggttgaatgctgtgtatcgtgggagatt
aactacctaaaaaagcaggagattattgaaagcatgagaaggaagctgtttgaggagatg
aaaggaattaacaactaccacatcactcacaagatagaggactactcacggatcaaagag
atcggtgacatcccgggggtttctggcgtcgagtgcattgtagaggaggatagaggcatg
aggctccaagccagatttatttcgtatctcatatctgatctccagagcaatgcgcatgcc
tggccgttcttaaggcctgtggacccggcagaggttcctgactactacaagtgcatagcc
aagcctatggatctatccacaatggtgctgaagctaaggaacaacgagtatgggtgcata
gaagcatttgtggcggatgtccatctgatggtgaacaattgttttgaatataatggaagg
gacacgcagtactataaatgcgctcaggcacttctggaccactttaacaaaaagcttgag
ttttatagacatgttgttggcaggctttcgacaaaaagaggagccgattaa

DBGET integrated database retrieval system