KEGG   Encephalitozoon cuniculi: ECU11_0230Help
Entry
ECU11_0230        CDS       T00105                                 

Definition
TRIOSE PHOSPHATE ISOMERASE
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ecu  Encephalitozoon cuniculi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECU11_0230
   01230 Biosynthesis of amino acids
    ECU11_0230
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECU11_0230
   00051 Fructose and mannose metabolism
    ECU11_0230
   00562 Inositol phosphate metabolism
    ECU11_0230
Enzymes [BR:ecu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ECU11_0230
Exosome [BR:ecu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ECU11_0230
  Exosomal proteins of bladder cancer cells
   ECU11_0230
  Exosomal proteins of melanoma cells
   ECU11_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
XI:complement(29038..29766)
Genome map
AA seq 242 aa AA seqDB search
MKGNKLLAGNWKMSSSLQTFEIIKSFRANLFAGNDTFIAVPFPYIHVAKKMFPEYIKVGA
QDCSQFKSGPYTGEVSASMVSEMGAEYVIIGHSERRRWFGETSATVVKKIRNARSEGLKI
VVCIGEDEKCREDGRHLDVIKDQLLSLGEEIGGEGIDIAYEPVWAIGTGKVPTNDQIREV
VSGIKRWGTGMGFVGRVIYGGSVSMLNCQTILDVEEIDGFLIGGTSLKMDFCMISSEMST
KT
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaaacaaacttcttgcaggaaactggaagatgagttcgtcgttacaaactttt
gagataattaaaagcttccgagcgaatctctttgccggaaacgatacgtttattgccgtt
ccgtttccttatattcatgtcgcgaagaagatgtttcctgagtacatcaaggttggagcg
caggattgcagtcagtttaaaagtggcccgtacacaggtgaagtctctgcatccatggtg
agcgagatgggtgctgagtatgtgataatcggccattctgaaagacgtaggtggtttgga
gagacgtctgcgactgtagtaaaaaagattaggaatgctcggagtgagggcctgaagatt
gttgtgtgcattggggaagacgagaaatgcagggaggacggaaggcacttggatgtaata
aaggaccagttactgtctctgggagaggagattgggggagaaggcattgacattgcatat
gagcctgtatgggctataggaacggggaaggttcccaccaatgatcagatcagagaggtg
gtttctgggattaagagatggggtacgggcatggggtttgttgggcgtgtgatatatggg
gggtctgtctcgatgttgaactgccaaactatcctcgatgtagaggaaatagatggtttc
ttgattggcggaacctcgttgaaaatggacttttgtatgatttcaagtgagatgagtacg
aagacgtga

DBGET integrated database retrieval system