KEGG   Encephalitozoon cuniculi: ECU11_0660Help
Entry
ECU11_0660        CDS       T00105                                 

Definition
SER/THR PROTEIN PHOSPHATASE PPI-1 CATALYTIC SUBUNIT
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ecu  Encephalitozoon cuniculi
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    ECU11_0660
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    ECU11_0660
Enzymes [BR:ecu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     ECU11_0660
Protein phosphatases and associated proteins [BR:ecu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     ECU11_0660
Transcription machinery [BR:ecu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     ECU11_0660
Spliceosome [BR:ecu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    ECU11_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
XI:complement(90501..91454)
Genome map
AA seq 317 aa AA seqDB search
MSNERVDLDTIIEKLLSVRNSKLGRLVHLAEAEMRYLCEKSTDVFKQQPTLVEVKAPVKI
CGDVHGQYYDLLKLFEHGGFPPSSNYLFLGDYVDRGKQSLETICLLLAYKIKFPNNFFLL
RGNHECASINRIYGFYDECKRRYDTTVWKMFTECFNWIPVCALVDGRILCMHGGISPDLK
SMDQIKGIARPTDVPDEGLLCDLLWSDPDPSVRGWGENDRGVSVTFGPDTVERFLEAHNL
DLICRAHQVVEDGYEFFANRSLVTVFSAPNYCGEFENSGAIMDVDKDLVCSFQVLKPTDF
ISSGEPRKKQMGMSRKK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgaaagggttgacttggacacgataatagaaaagcttctttctgtccggaac
agtaagctggggaggctagtccaccttgcagaggcagagatgagatacttgtgtgaaaag
tcgactgatgtattcaagcagcagccaactctagttgaggtgaaggctccagttaagatc
tgtggagatgtgcacgggcaatactatgatcttctgaagctgtttgagcacggcggattt
cctccctcgagcaactacttgtttctcggcgactatgtggaccggggaaagcagtctctg
gagacgatctgcttgctgctggcatacaagatcaagtttccaaacaacttcttcctgctg
agagggaatcacgagtgcgccagcatcaataggatatatggtttttacgacgagtgcaag
aggagatatgacacaacggtgtggaagatgttcaccgagtgcttcaactggattccggtg
tgtgcccttgttgacggaaggatcctctgcatgcacggcgggatttcgcctgacctgaag
agcatggaccagatcaaggggattgcaaggcccacagatgttcctgatgaaggtctgctg
tgcgatcttctgtggagtgacccggatcccagtgtgaggggatggggagagaacgataga
ggggtttctgtaacgtttgggccggatactgtggagaggtttctcgaagcacataatctg
gacctgatatgcagggcacaccaggttgtggaggacgggtatgagttctttgcaaacaga
tcactggtcactgtgttttctgctccaaactactgcggagagtttgagaactcaggagcg
attatggatgtagataaggatcttgtgtgttcatttcaggttctcaagccgacggatttc
attagtagtggagaacccaggaagaagcagatggggatgtctcgtaaaaagtaa

DBGET integrated database retrieval system