KEGG   Encephalitozoon cuniculi: ECU11_0660Help
Entry
ECU11_0660        CDS       T00105                                 

Definition
SER/THR PROTEIN PHOSPHATASE PPI-1 CATALYTIC SUBUNIT
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ecu  Encephalitozoon cuniculi
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:ecu03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ecu04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
XI:complement(90501..91454)
Genome map
AA seq 317 aa AA seqDB search
MSNERVDLDTIIEKLLSVRNSKLGRLVHLAEAEMRYLCEKSTDVFKQQPTLVEVKAPVKI
CGDVHGQYYDLLKLFEHGGFPPSSNYLFLGDYVDRGKQSLETICLLLAYKIKFPNNFFLL
RGNHECASINRIYGFYDECKRRYDTTVWKMFTECFNWIPVCALVDGRILCMHGGISPDLK
SMDQIKGIARPTDVPDEGLLCDLLWSDPDPSVRGWGENDRGVSVTFGPDTVERFLEAHNL
DLICRAHQVVEDGYEFFANRSLVTVFSAPNYCGEFENSGAIMDVDKDLVCSFQVLKPTDF
ISSGEPRKKQMGMSRKK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgaaagggttgacttggacacgataatagaaaagcttctttctgtccggaac
agtaagctggggaggctagtccaccttgcagaggcagagatgagatacttgtgtgaaaag
tcgactgatgtattcaagcagcagccaactctagttgaggtgaaggctccagttaagatc
tgtggagatgtgcacgggcaatactatgatcttctgaagctgtttgagcacggcggattt
cctccctcgagcaactacttgtttctcggcgactatgtggaccggggaaagcagtctctg
gagacgatctgcttgctgctggcatacaagatcaagtttccaaacaacttcttcctgctg
agagggaatcacgagtgcgccagcatcaataggatatatggtttttacgacgagtgcaag
aggagatatgacacaacggtgtggaagatgttcaccgagtgcttcaactggattccggtg
tgtgcccttgttgacggaaggatcctctgcatgcacggcgggatttcgcctgacctgaag
agcatggaccagatcaaggggattgcaaggcccacagatgttcctgatgaaggtctgctg
tgcgatcttctgtggagtgacccggatcccagtgtgaggggatggggagagaacgataga
ggggtttctgtaacgtttgggccggatactgtggagaggtttctcgaagcacataatctg
gacctgatatgcagggcacaccaggttgtggaggacgggtatgagttctttgcaaacaga
tcactggtcactgtgttttctgctccaaactactgcggagagtttgagaactcaggagcg
attatggatgtagataaggatcttgtgtgttcatttcaggttctcaagccgacggatttc
attagtagtggagaacccaggaagaagcagatggggatgtctcgtaaaaagtaa

DBGET integrated database retrieval system