KEGG   Encephalitozoon cuniculi: ECU11_1160Help
Entry
ECU11_1160        CDS       T00105                                 

Definition
(RefSeq) POSSIBLE PROTEIN OF NUCLEAR SCAFFOLD
  KO
K03350  
anaphase-promoting complex subunit 3
Organism
ecu  Encephalitozoon cuniculi
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ecu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    ECU11_1160
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    ECU11_1160
   04113 Meiosis - yeast
    ECU11_1160
Protein phosphatases and associated proteins [BR:ecu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     ECU11_1160
Ubiquitin system [BR:ecu04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     ECU11_1160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
XI:complement(145772..147199)
Genome map
AA seq 475 aa AA seqDB search
MDSKLIGKICKSIRYRDYETAIFLAACLLPCKPEYRMLMSIVLYLNGEYTRALFHLHKLN
TCTSKYYESLCYKKKKDYKKAIKSLESILEGKVERDPDVDARIQEMFVDPGDEEFFESLL
GDLCTLSGYREEGIGHYVRSFGKSFLFSPVENLLLENKVPQKRDKENVRQTGRRGIEEEY
VSDSIEFHESLSPSLVKKYMEHVPGIGSYFISNAARRYFNLGMNDKSKACFELVRRKDPM
FLHNVDYYSTILWHSKDVYELGMLCKNLIKHAPDSPNTWKALGNFYSHQGDYQRSVLCFK
RSLCIEEDSYTYTLLGYESIQRNEYDIAMKYFNLSLKMLGDNYRAMFGCGLVYTKTEKLE
NAEFFLKKAIETNPRNLQIKVHAMKFYTRKGLTDQSIRLFKEAFHMEYTDIHRIVECILS
RKGSFSDVEEFLLLEFVEILVLQNLSKLAADVLSCVEYRGESYSKKKELVMDRTE
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggactcgaagttgattgggaagatatgcaagtcgataaggtatagggactacgagact
gcgatttttctagcggcatgcctactcccgtgcaagcctgaatacagaatgctcatgtcc
atagtgctctatctgaacggcgaatacacccgtgccctcttccatcttcacaagcttaac
acatgcacatcaaagtactacgagtctctgtgctacaagaagaagaaggactacaagaag
gccatcaaaagcctggagtctattctcgagggaaaggttgaaagggatcctgatgtcgat
gcaaggatacaggagatgtttgtcgacccaggcgacgaggagttttttgagtctctcctt
ggagacctatgcactctatctgggtacagagaagagggcattgggcactatgtaaggtct
tttgggaagagcttcctgttttcacctgtggaaaacctcttgctcgagaacaaggttccg
cagaaaagagacaaggagaatgtccggcagaccgggaggagggggatagaagaagagtac
gtgtctgacagcattgagttccatgagagtctgtcgccgtccctcgtaaagaagtacatg
gagcatgttccggggattggatcctacttcatttcgaatgctgcacggagatacttcaat
ctcgggatgaatgacaagagcaaagcatgctttgagctggtcaggagaaaggatccaatg
tttctgcacaatgtggactactactcgaccatcctctggcactctaaggatgtttacgag
ctcgggatgctgtgcaagaacctgatcaagcacgcgccagactcgccgaacacctggaag
gcgctggggaacttctacagccaccagggcgactaccaaagaagcgttctgtgcttcaaa
aggagcctgtgcatagaagaggactcctacacctacacactccttggatatgaatcgatc
cagagaaacgagtatgacatagccatgaagtacttcaacctgtcgctcaagatgcttgga
gacaactacagggcaatgttcggctgtggactggtctacaccaagacggaaaagctagaa
aatgcagagttttttctgaagaaggccatagaaacaaaccctaggaacctccagattaag
gtgcatgcaatgaagttctatacacgcaagggacttaccgaccagtcgataaggctcttc
aaggaagcgttccacatggagtacacagacatccacagaattgttgaatgcattctttcc
aggaagggaagcttcagcgatgtcgaggagttcctcctccttgagtttgtggagattctt
gtcctccagaatctgtccaagcttgctgcagatgttctgagctgtgtagagtacagagga
gagtcttacagcaagaaaaaggaacttgtgatggacaggacggaatag

DBGET integrated database retrieval system