KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_1117Help
Entry
APECO1_1117       CDS       T00425                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ecv01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ecv00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2179890..2181203
Genome map
AA seq 437 aa AA seqDB search
MIAMSFNTIIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDNVKTRGDEALREYSAK
FDKTTVTALKVSAEEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRC
QQVTRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCG
VRDVFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQASQRLDGAAIDMPAGPS
EVLVIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMARRVAEAVERQLAELPRAET
ARQALNASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARELVDGITSAGSVFLGDWSPES
AGDYASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKEGFSTLASTIETLAAAERLT
AHKNAVTLRVNALKEQA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccatgagctttaacacaatcattgactggaatagctgtactgcggagcaacaa
cgccagctgttaatgcgcccggcgatctccgcttctgaaagcattacccgcaccgttaac
gatattctcgataacgtgaaaacgcgtggcgatgaagccctgcgtgaatacagcgcgaag
tttgataaaaccacggttaccgcgctgaaggtgtctgctgaggagatcgccgccgccagc
gaacgcctgagcgacgagctaaaacaggcgatggcggtggcagtaaagaatattgaaacc
ttccacactgcgcaaaaactgccgccggtagatgtagaaacgcagccaggcgtgcgttgc
cagcaggtcacgcgcccggtggcttcagtgggtttgtatattcctggcggctccgccccg
ctcttctcaacggtattaatgctggcaactccggcgcgtattgcgggctgtaaaaaagtg
gtgctgtgctcaccgccgccgattgccgatgagatcctttatgcggcgcagctgtgcggt
gtgcgggacgtgtttaacgtcggcggcgcacaggccattgccgcactggcgtttggtaca
gaatccgtgccgaaagtggacaaaatcttcgggccaggtaacgcctttgtcaccgaggca
aaacgtcaggcgagccagcgtctggacggtgcggctatcgatatgcccgcaggcccgtcg
gaagtgttggtcattgctgacagcggcgctacgccggatttcgtggcttctgatttgctt
tctcaggctgaacacggcccggactcacaggtgattttactgacccccgacgccgatatg
gcgcgtcgcgttgccgaggccgtcgaacgccaactggcagaactgccgcgtgccgaaacc
gcccgccaggcactgaacgccagccgcctgatcgtgactaaagatttagcgcagtgcgtg
gagatctccaaccagtacggcccggagcacctgatcattcagacccgcaacgcccgcgaa
ctggtcgatggcatcaccagcgccggttcggtatttctcggtgactggtcaccggaatcg
gcaggtgattacgcctccggcaccaatcacgtgctgccgacttacggttacaccgccacc
tgttccagcctcgggctggcagatttccagaaacgcatgaccgtacaggaactgtcgaaa
gaaggcttttccacgctggcttcgaccattgaaacactggccgccgccgagcgcctgacc
gcccacaaaaatgccgttactttgcgtgttaacgcccttaaggagcaagcatga

DBGET integrated database retrieval system