KEGG   Escherichia coli APEC O1 (APEC): APECO1_1132Help
Entry
APECO1_1132       CDS       T00425                                 

Gene name
galF
Definition
(GenBank) putative UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00040  Pentose and glucuronate interconversions
ecv00052  Galactose metabolism
ecv00500  Starch and sucrose metabolism
ecv00520  Amino sugar and nucleotide sugar metabolism
ecv01100  Metabolic pathways
ecv01130  Biosynthesis of antibiotics
Module
ecv_M00362  Nucleotide sugar biosynthesis, prokaryotes
ecv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    APECO1_1132 (galF)
   00052 Galactose metabolism
    APECO1_1132 (galF)
   00500 Starch and sucrose metabolism
    APECO1_1132 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    APECO1_1132 (galF)
Enzymes [BR:ecv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     APECO1_1132 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: ABJ01437
UniProt: A0A0H2Z0B7
Position
complement(2200595..2201500)
Genome map
AA seq 301 aa AA seqDB search
MDEIMTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVT
HASKNAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILC
ARPAIGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSV
IQTKEPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRI
QLTDAIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLS
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggatgaaataatgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcat
atgttgcctgccactaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatg
attcagtacatcgttgacgagattgtggctgcagggatcaaagaaatcctcctggtaact
cacgcttccaagaacgcggtcgaaaaccacttcgacacctcttatgaattagaatctctc
cttgaacagcgcgtgaagcgtcaactgctggcggaagtacagtccatttgcccgccgggc
gtgacaattatgaacgtgcgtcagggcgaacctttaggtttgggccactccattttatgt
gcacgacctgccattggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgac
gacgccagcgccgacccgctgcgctacaaccttgctgccatgattgcgcgcttcaacgaa
acgggccgcagccaggtgctggcaaaacgtatgccgggtgacctctctgaatactctgtc
atccagaccaaagagccgctggaccgcgaaggtaaagtcagccgcattgttgaattcatc
gaaaaaccggatcagccgcagacgctggactcagacatcatggccgttggtcgctatgtg
ctttctgccgatatttggccggaactggaacgcacgcagcctggtgcatgggggcgtatt
cagctgactgatgccattgccgaactggcgaaaaaacagtccgttgatgccatgctgatg
accggcgacagctacgactgcggtaaaaaaatgggttatatgcaagcgttcgtgaagtat
ggactacgcaacctcaaagaaggggcgaagttccgtaaagggattgagaagctgttaagc
gaataa

DBGET integrated database retrieval system