KEGG   Escherichia coli APEC O1 (APEC): APECO1_1332Help
Entry
APECO1_1332       CDS       T00425                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00010  Glycolysis / Gluconeogenesis
ecv00052  Galactose metabolism
ecv01100  Metabolic pathways
ecv01110  Biosynthesis of secondary metabolites
ecv01120  Microbial metabolism in diverse environments
ecv01130  Biosynthesis of antibiotics
Module
ecv_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APECO1_1332 (galM)
   00052 Galactose metabolism
    APECO1_1332 (galM)
Enzymes [BR:ecv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     APECO1_1332 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABJ00139
UniProt: A0A0H2YX23
Position
complement(752585..753625)
Genome map
AA seq 346 aa AA seqDB search
MLNETPALAPDGQPYRLLTLRNNAGMVVTLMDWGATLLSARIPLSDGSVREALLGCASPE
CYQDQAAFLGASIGRYANRIANSRYTFDGETVTLSPSQGVNQLHGGPEGFDKRRWQIVNQ
NDRQVLFALSSDDGDQGFPGNLGATVQYRLTDDNRISITYRATVDKPCPVNMTNHVYFNL
DGEQSDVRNHKLQILAEEYLPVDEGGIPHDGLKSVAGTSFDFRNAKIIASEFLADDDQRK
VKGYDHAFLLQAKGDGKKVAAHVWSADEKLQLKVYTTAPALQFYSGNFLGGTPSRGTEPY
ADWQGLALESEFLPDSPNHPEWPQPDCFLRPGEEYSSLTEYQFIAQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaacgaaactcccgcactggcacccgatggtcagccgtaccgactgttaactttg
cgtaacaacgcagggatggtagtcacgctgatggactggggtgcgactttactttccgcc
cgtattccgctttccgatggcagcgtccgcgaggcgctgcttggctgcgccagcccggaa
tgctatcaggatcaggccgcatttctgggggcctctattggtcgttatgccaaccgcatc
gccaatagccgttatacctttgacggtgaaaccgtgacgctttcaccaagtcagggcgtc
aaccaattgcatggcggcccggaagggttcgacaaacgtcgctggcagattgtgaaccag
aacgatcgtcaggtgctgtttgccctgagttcagatgatggcgatcagggtttcccgggt
aatctcggcgcgacggtgcaatatcgtctgaccgacgataaccgtatctccattacttat
cgcgccacagttgataaaccttgcccggtgaatatgactaatcacgtctatttcaatctt
gacggcgagcaatctgacgtgcgcaatcacaagttgcagattctggcggaagaatatctg
ccggttgatgaaggcggcattccgcacgacggcctgaaatctgtcgccggaacctctttt
gatttccgcaacgccaaaatcatcgccagtgagtttcttgccgacgacgatcagcgcaaa
gtgaaaggttacgatcacgcgttcttgttacaggccaaaggcgatggcaagaaagtggcg
gcgcatgtctggtcagcagatgaaaaattgcagctgaaggtctacaccaccgctccggct
ctgcaattctactccggcaacttcctcggcggcacaccgtcgcggggaaccgaaccttac
gccgactggcaagggctggctctggaaagcgaatttctgccggacagcccgaaccaccct
gaatggccgcaaccggactgcttcctgcgtcctggcgaagagtattccagcctgacggaa
tatcagtttattgctcagtaa

DBGET integrated database retrieval system