KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_1355Help
Entry
APECO1_1355       CDS       T00425                                 

Gene name
sdhA
Definition
succinate dehydrogenase flavoprotein subunit (EC:1.3.99.1)
Orthology
K00239  
succinate dehydrogenase flavoprotein subunit [EC:1.3.99.1]
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:ecv01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ecv00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ecv00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:ecv00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
725083..726861
Genome map
AA seq 592 aa AA seqDB search
MGCVMKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVA
LGNTHEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQ
RPFGGQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGA
VVGCTALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDM
EMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIE
IREGRGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYM
MGGIPTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAG
LHLQESIAEQGALRDASESDVEASLDRLNRWNNNRNGEDPVAIRKALQECMQHNFSVFRE
GDAMAKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTES
RGAHSRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtggggtgtgtgatgaaattgccagtcagagaatttgatgcagttgtgattggtgctggc
ggcgcaggtatgcgcgcggcgctgcaaatttcccagagtggccagacctgtgcgctgctc
tctaaagtcttcccgacccgttcccataccgtttctgcgcaaggtggtattaccgttgcg
ctgggtaatacccatgaagataactgggaatggcatatgtacgacaccgtaaaagggtcg
gactatatcggtgaccaggacgcgattgaatatatgtgtaaaaccgggccggaagcgatt
ctggaactggaacatatgggcctgccgttctcgcgtcttgatgatggtcgtatctatcaa
cgtccgtttggcggtcagtcgaaaaacttcggcggcgagcaggcggcacgtactgcggcg
gctgccgaccgtaccggtcacgcactgttgcacacgctttatcagcagaacctgaaaaac
cacaccaccattttctccgagtggtatgcgctggatctggtgaaaaaccaggatggcgca
gtggtcggttgtaccgcactgtgcatcgaaactggtgaagtggtttactttaaagctcgc
gcgacagtgctggcgactggcggggcagggcgtatttatcagtccaccaccaacgcccac
attaacactggcgacggtgtcggcatggctatccgtgcaggcgtaccggtacaggatatg
gaaatgtggcagttccacccgacaggtattgccggtgcgggcgtactggtcaccgaaggt
tgccgtggtgaaggcggttatctgctgaacaaacatggcgaacgctttatggaacgttat
gcgccgaacgccaaagacctggcgggccgtgacgtggtggcgcgttccatcatgatcgaa
atccgtgaaggccgcggctgtgatggtccgtgggggccacacgcaaaactgaaacttgac
catctgggtaaagaagttcttgaatcccgtctgccgggtatccttgaactctcccgcacc
ttcgctcacgtcgatccggtgaaagagccgattccggttatcccaacctgtcactacatg
atgggcggtattccgaccaaagtgaccggtcaggcgctgactgtgaatgagaaaggcgaa
gatgtggttgttccggggctatttgccgttggtgaaatcgcttgtgtatcggtacatggc
gctaaccgtctgggcggcaactcgctgctggacctggtcgtatttggtcgtgcggcaggt
ctgcatctgcaagagtctatcgccgagcagggcgcactgcgcgatgccagcgagtctgat
gtagaagcgtctctggatcgcctgaaccgctggaacaataaccgtaacggtgaagatccg
gtggcgatccgtaaagcactgcaagaatgtatgcagcataacttctcggtcttccgtgaa
ggtgatgcgatggcgaaagggcttgagcagttgaaagttatccgcgagcgtctgaaaaat
gcccgtctggatgacacttccagcgagttcaacacccagcgcgttgagtgcctggaactg
gataacctgatggaaacggcgtatgcaacggctgtttctgccaacttccgtaccgaaagc
cgtggcgcgcatagccgcttcgacttcccggatcgcgatgatgaaaactggctgtgccac
tccctgtatctgccagagtcggaatccatgacgcgccgaagcgtcaacatggaaccgaaa
ctgcgcccggcattcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system