KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_1635Help
Entry
APECO1_1635       CDS       T00425                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ecv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(405758..406765)
Genome map
AA seq 335 aa AA seqDB search
MLLDSTNIRQTMTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEA
MPGVMRIPEKHLAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQT
VPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMD
GQVQAIRQALDAAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMNPMNRREA
IRESLLDEAQGADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFAALAGAID
EEKVVLESLGSIKRAGADLIFSYFALDLAEKKILR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgctcctcgattccacaaacatcaggcagaccatgacagatttaatccaacgccctcgt
cgcctgcgcaaatctcctgcgctgcgcgctatgtttgaagagacaacacttagccttaac
gacctggtgttgccgatctttgttgaagaagaaattgacgactacaaagccgttgaagcc
atgccaggcgtgatgcgcattccagagaaacatctggcacgcgaaattgaacgcatcgcc
aacgccggtattcgttccgtgatgactttcggcatctctcaccataccgatgaaaccggc
agcgatgcctggcgggaagatggactggtggcgcgtatgtcgcgcatctgcaagcagacc
gtgccagaaatgatcgttatgtcagacacctgcttctgtgaatacacatctcacggtcac
tgcggtgttctgtgcgagcatggcgtcgacaacgacgcgactctggaaaatttaggcaag
caagctgtggttgcagctgctgcaggcgcagacttcatcgccccttctgccgcgatggat
ggtcaggtacaggcgattcgccaggcgctggacgctgcgggctttaaagatacggcgatt
atgtcgtattcgaccaagttcgcctcctccttttatggcccgttccgtgaagctgccgga
agcgcattaaaaggcgaccgcaaaagctatcagatgaacccaatgaaccgtcgtgaggcg
attcgtgagtcgctgctggatgaagcccagggcgcagactgcctgatggttaaacctgcc
ggagcatacctcgacatcgtgcgtgagctgcgtgaacgtactgaattgccgattggcgcg
tatcaggtgagcggtgagtacgcgatgattaagttcgccgcgctggcgggtgctatagat
gaagagaaagtcgtgctcgaaagcttaggttcgattaagcgtgcgggtgcggatctgatt
ttcagctactttgcgctggatttggctgagaagaagattctgcgttaa

DBGET integrated database retrieval system