KEGG   Escherichia coli APEC O1 (APEC): APECO1_1635Help
Entry
APECO1_1635       CDS       T00425                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00860  Porphyrin and chlorophyll metabolism
ecv01100  Metabolic pathways
ecv01110  Biosynthesis of secondary metabolites
ecv01120  Microbial metabolism in diverse environments
Module
ecv_M00121  Heme biosynthesis, glutamate => heme
ecv_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APECO1_1635 (hemB)
Enzymes [BR:ecv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     APECO1_1635 (hemB)
Exosome [BR:ecv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APECO1_1635 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD ComA
Motif
Other DBs
NCBI-ProteinID: ABI99834
UniProt: A0A0H2YWL6
Structure
PDB: 

Jmol
Position
complement(405758..406765)
Genome map
AA seq 335 aa AA seqDB search
MLLDSTNIRQTMTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEA
MPGVMRIPEKHLAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQT
VPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMD
GQVQAIRQALDAAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMNPMNRREA
IRESLLDEAQGADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFAALAGAID
EEKVVLESLGSIKRAGADLIFSYFALDLAEKKILR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgctcctcgattccacaaacatcaggcagaccatgacagatttaatccaacgccctcgt
cgcctgcgcaaatctcctgcgctgcgcgctatgtttgaagagacaacacttagccttaac
gacctggtgttgccgatctttgttgaagaagaaattgacgactacaaagccgttgaagcc
atgccaggcgtgatgcgcattccagagaaacatctggcacgcgaaattgaacgcatcgcc
aacgccggtattcgttccgtgatgactttcggcatctctcaccataccgatgaaaccggc
agcgatgcctggcgggaagatggactggtggcgcgtatgtcgcgcatctgcaagcagacc
gtgccagaaatgatcgttatgtcagacacctgcttctgtgaatacacatctcacggtcac
tgcggtgttctgtgcgagcatggcgtcgacaacgacgcgactctggaaaatttaggcaag
caagctgtggttgcagctgctgcaggcgcagacttcatcgccccttctgccgcgatggat
ggtcaggtacaggcgattcgccaggcgctggacgctgcgggctttaaagatacggcgatt
atgtcgtattcgaccaagttcgcctcctccttttatggcccgttccgtgaagctgccgga
agcgcattaaaaggcgaccgcaaaagctatcagatgaacccaatgaaccgtcgtgaggcg
attcgtgagtcgctgctggatgaagcccagggcgcagactgcctgatggttaaacctgcc
ggagcatacctcgacatcgtgcgtgagctgcgtgaacgtactgaattgccgattggcgcg
tatcaggtgagcggtgagtacgcgatgattaagttcgccgcgctggcgggtgctatagat
gaagagaaagtcgtgctcgaaagcttaggttcgattaagcgtgcgggtgcggatctgatt
ttcagctactttgcgctggatttggctgagaagaagattctgcgttaa

DBGET integrated database retrieval system