KEGG   Escherichia coli APEC O1 (APEC): APECO1_1727Help
Entry
APECO1_1727       CDS       T00425                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00330  Arginine and proline metabolism
ecv00332  Carbapenem biosynthesis
ecv01100  Metabolic pathways
ecv01130  Biosynthesis of antibiotics
ecv01230  Biosynthesis of amino acids
Module
ecv_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    APECO1_1727 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    APECO1_1727 (proB)
Enzymes [BR:ecv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     APECO1_1727 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABI99742
UniProt: A1A7V3
Structure
PDB: 

Jmol
Position
292561..293664
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPR
SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPG
VIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVDEGATAAILERGSSLLPKGI
KSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtggtaaaactcggcaccagtgtgctaacaggcggatcg
cgccgcctgaaccgtgcccatatcgttgaacttgttcgccagtgcgcgcagttacatgcc
gccgggcatcggattgttattgtgacgtcaggtgcgattgccgccggacgtgagcacctg
gggtacccggaattgccagcgactatcgcttcaaaacagctgctggcggcggtagggcag
agtcgactgattcaactgtgggaacagctgttttcaatttacggcattcatgtcgggcag
atgttgctgacccgtgctgatatggaagatcgtgaacgcttcctgaacgcccgcgatacc
ctgcgtgcgttgctcgataacaatatcgttccggtaattaatgagaacgatgctgtcgct
actgcagagattaaggtcggtgataacgataacctttctgcgctggcggcgattctggcg
ggtgccgataaactgttgctgctgaccgatcaaaaaggtttgtataccgctgacccgcgc
agcaatccgcaggcagaactgattaaagatgtgtacggcattgatgacgcactgcgcgcg
attgccggtgatagcgtttcaggcctcggaactggcggtatgagcaccaaattgcaggcc
gctgacgtggcttgccgtgcgggtatcgacaccattattgccgcgggcagcaagccgggc
gttattggtgatgtgatggaaggcatttccgtcggtacgctgttccatgcccaggcgact
ccgcttgaaaaccgtaaacgctggattttcggtgcgccgcctgcgggtgaaatcacggta
gatgaaggggcaactgccgccattctggaacgcggcagctccctgttgccgaaaggcatt
aaaagcgtgactggcaatttctcgcgtggtgaagtcatccgtatttgcaacctcgaaggt
cgcgatatcgcccacggcgtcagtcgttacaacagcgatgcattacgccgtattgccgga
caccactcgcaagaaattgatgcaatactgggatatgaatacggcccggttgccgttcac
cgtgatgacatgattacccgttaa

DBGET integrated database retrieval system