KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_1843Help
Entry
APECO1_1843       CDS       T00425                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ecv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(163275..163754)
Genome map
AA seq 159 aa AA seqDB search
MTVAYIAIGSNLASPLEQVNAALKALGDIPESRILAVSSFYRTPPLGPQDQPDYLNAAVA
LKTTLAPEGLLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELVFPDGLSLVEALQAKGFNELDKW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatattgccataggcagcaatctggcctctccgctggagcaggtcaat
gctgccctgaaagcattaggcgatattccagaaagccgcattcttgctgtttcttcgttt
taccgcaccccaccgctggggccgcaagatcaacccgattacttaaatgccgccgtcgcg
ctgaaaaccactcttgcccctgaagggctactcaatcacacacagcgtatcgaattgcag
caaggtcgcgtccgtaaagctgaacgctggggaccgcgcacgctggatctcgacatcatg
ctgtttggtaatgaagtaataaataccgaacgtctgaccgttccgcactacgatatgaaa
aatcgcggctttatgctgtggccactgtttgaaattgcgccggaattggtatttcctgat
ggcttatcattagttgaagctctacaggcaaaaggctttaatgaattagataagtggtaa

DBGET integrated database retrieval system