KEGG   Escherichia coli APEC O1 (APEC): APECO1_188Help
Entry
APECO1_188        CDS       T00425                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    APECO1_188 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    APECO1_188 (nagZ)
Enzymes [BR:ecv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     APECO1_188 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1146446..1147471
Genome map
AA seq 341 aa AA seqDB search
MGPVMLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVCQIRAASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAQEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHADPQKALAIASRFIDGMHEAGMKTTGKHFPGHGAVTADSHKETP
CDPRPQAEIRAKDMSVFSSLIRENKLDAIMPAHVIYSDVDPRPASGSPYWLKTVLRQELG
FDGVIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TRLYHKGSFSRQELMDSARWKAISTRLNQLHERWQEEKAGH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgggtccagtaatgttggatgtcgaaggttacgaactggacgcggaagagcgtgaaata
ctggcgcatccgctggtgggagggctgattctctttacgcgaaactatcatgatcctgcc
cagttacgtgaactggtgtgccagatccgcgcagcatcgcgcaatcatctggtggtggcg
gtagatcaggaaggtggacgcgtgcagcgttttcgtgaaggttttacccgcttgccagcg
gcacaatcattcgctgcgctgttgggaatggaagaaggcggaaaactggcgcaagaggca
ggttggttgatggccagtgaaatgattgctatggatattgatatcagctttgcgccagtg
ctggacgtcgggcatatcagcgcggcgattggcgagcgttcttatcatgccgatccacaa
aaagccctggcaattgccagccgttttattgatggtatgcatgaagcgggaatgaaaact
accgggaaacacttcccaggtcacggtgcagtaacggcagactcacacaaagaaacaccg
tgcgacccacgtccgcaagcggagattcgcgctaaagatatgtcggtcttcagttcctta
atccgcgaaaataaactcgacgccattatgcctgcgcatgtgatctacagtgatgttgat
ccgcgtccggcgagcggttctccctactggctgaaaaccgttttgcgtcaggaattgggt
tttgacggcgtgattttctctgacgatttatcgatggaaggcgcagcgattatgggcagt
tatgccgagcgtggacaggcatcactggatgcaggttgcgatatgatcctggtctgcaat
aatcgtaaaggggccgtcagcgtgttagataatctgtcaccgatcaaggcagaacgtgtt
acacgtttgtatcataaaggttcattttcgcgacaggaactgatggactcggctcgctgg
aaagcgatcagcacccgtctgaatcagttacatgaacgctggcaggaagagaaggcaggt
cattaa

DBGET integrated database retrieval system