KEGG   Escherichia coli APEC O1 (APEC): APECO1_1974Help
Entry
APECO1_1974       CDS       T00425                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00260  Glycine, serine and threonine metabolism
ecv00750  Vitamin B6 metabolism
ecv01100  Metabolic pathways
ecv01110  Biosynthesis of secondary metabolites
ecv01120  Microbial metabolism in diverse environments
ecv01230  Biosynthesis of amino acids
Module
ecv_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APECO1_1974 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    APECO1_1974 (thrC)
Enzymes [BR:ecv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     APECO1_1974 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABI99496
UniProt: A0A0H2YVC7
Structure
PDB: 

Jmol
Position
3714..5000
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQILTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
RKLMMNHQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatctgaaagatcacaatgagcaggtcagctttgcgcaagccgtaacc
caggggttgggcaaaaatcaggggctgtttttcccgcacgacctgccggaattcagcctg
actgaaattgatgagatgctgaagctggattttgtcacccgcagtgcgaagatcctctcg
gcgtttattggtgatgaaatcccgcaggaaatcctggaagagcgcgtacgcgcggcgttt
gccttcccggctccggtcgccaatgttgaaagcgatgtcggttgtctggaattgttccac
gggccaacgctggcatttaaagatttcggcggtcgctttatggcacaaatactgacccat
attgcgggcgataagccagtgaccattctgaccgcgacatccggtgatactggagcggca
gtggctcatgctttctacggtttaccgaatgtgaaagtggttatcctctatccacgaggc
aaaatcagtccactgcaagaaaaactgttctgtacattgggcggcaatatcgaaactgtt
gccatcgacggcgatttcgatgcctgtcaggcgctggtgaagcaggcgtttgatgatgaa
gaactgaaagtggcgctggggctaaactctgctaactccattaacatcagccgtttgctg
gcgcagatttgctactactttgaagctgttgcgcagctgccgcaggaagcgcgcaaccag
ctggttgtctcggtgccaagcggaaacttcggcgatttgacggcgggtctgctggcgaag
tcactcggtctgccggtgaaacgttttattgctgcgaccaacgtgaacgataccgtgcca
cgtttcctgcacgacggtcagtggtcacccaaagcgactcaggcgacgttatccaatgcg
atggatgttagccagccaaacaactggccgcgtgtggaagagttgttccgccgcaaaatc
tggcaactgaaagagctggggtatgcagccgtggatgatgaaaccacgcaacagacaatg
cgtgagttaaaagaactgggctatacctcggagccgcacgctgccgtagcttatcgtgcg
ctgcgtgaccagttgaatccaggcgaatatggcttgttcctcggcaccgcgcatccggcg
aaatttaaagagagcgtggaagcgattctcggtgaaacgttggatctgccaaaagagctg
gcagaacgtgctgatttacccttgctttcgcataacctgcccgccgattttgctgcgttg
cgtaaattgatgatgaatcatcagtaa

DBGET integrated database retrieval system