KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_2033Help
Entry
APECO1_2033       CDS       T00425                                 

Gene name
ydfQ
Definition
Qin prophage; lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5020958..5021491
Genome map
AA seq 177 aa AA seqDB search
MNVKIRYSLSAAVLALIAASAPAPDILDQFLDEKEGNHTTAYRDGSGIWTICRGATMVDG
KPVIPGMKLSKEKCAQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVIRRDQESALTCWGIEQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaaaaatcagatacagcctgtcggctgctgttctggcactgattgccgccagt
gctcctgcccctgacattctcgatcagtttctggatgaaaaagaggggaatcacaccact
gcataccgcgatggctccggcatatggaccatctgtcggggagcaacgatggtggacggt
aaacctgttattccgggaatgaaactgtcgaaggaaaaatgcgcccaggttaacgccatt
gagcgggataaggcgctggcatgggtggagcgcaatataaaagttccactgaccgagcca
cagaaagccggtatcgcgtcattctgtccctataacattggccctggtaagtgttttccg
tcgacgttttataagcggcttaatgccggtgatcgtaaaggcgcatgcgaggcgattcgc
tggtggataaaggacggtggacgtgattgccgcattcgttcaaataattgttacggtcag
gttattcgtcgtgaccaggagagtgcattaacctgctgggggatagaacagtga

DBGET integrated database retrieval system