KEGG   Escherichia coli APEC O1 (APEC): APECO1_2147Help
Entry
APECO1_2147       CDS       T00425                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase, catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00240  Pyrimidine metabolism
ecv00250  Alanine, aspartate and glutamate metabolism
ecv01100  Metabolic pathways
Module
ecv_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    APECO1_2147 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    APECO1_2147 (pyrB)
Enzymes [BR:ecv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     APECO1_2147 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABJ03790
UniProt: A1AJF0
Structure
PDB: 

Jmol
Position
complement(4886253..4887188)
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GNVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGDLKYGRTVHSLTQALAKF
DGNRFYFIAPDALAMPQYILDMLDEKGIAWSLHSSIEEVMAEVDILYMTRVQKERLDPSE
YANVKAQFVLRASDLHNAKANMKVLHPLPRVDEIATDVDKTPHAWYFQQAGNGIFARQAL
LALVLNRDLVL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaatccgctatatcagaaacatatcatttccataaacgaccttagtcgcgatgac
cttaatctggtgctggcgacagcggcgaaactgaaagcgaacccgcaaccagagctgttg
aagcacaaagttattgccagctgtttcttcgaagcctctacccgcacccgcctctctttc
gaaacttccatgcaccgcctgggtgccagcgtggtgggcttctccgacagcgccaataca
tcactgggtaaaaagggcgaaacgctggccgataccatttcggttatcagcacttacgtc
gatgcgatagtgatgcgtcatccgcaggaaggtgcagcgcgcctggccaccgagttttcc
ggcaatgtaccggtactgaatgccggtgatggctccaaccaacatccgacgcaaaccttg
ctggacttattcaccattcaggaaacccaggggcgtctggacaatctccacgtcgcaatg
gttggtgacctgaaatatggccgcaccgttcactccctgacccaggcgctagcgaagttc
gacggcaaccgtttttactttatcgcgccggatgcgctggcaatgccgcaatacattctg
gatatgctcgatgaaaaagggatcgcctggagtctgcacagctctattgaagaagtgatg
gcggaagtagacatcctgtacatgacccgcgtgcaaaaagagcgtctggacccgtccgag
tacgccaacgtgaaagcgcagtttgttcttcgcgccagcgatctccacaacgccaaagcc
aatatgaaagtgctgcatccgctgccgcgtgttgatgagattgcgacggatgtggataaa
acgcctcacgcctggtacttccagcaagcaggcaacgggattttcgctcgccaggcgtta
ctggcactggttctgaatcgcgatctggtactgtaa

DBGET integrated database retrieval system