KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_2383Help
Entry
APECO1_2383       CDS       T00425                                 

Gene name
nrfC
Definition
formate-dependent nitire reductase subunit NrfC
Orthology
K04014  
protein NrfC
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4631504..4632175
Genome map
AA seq 223 aa AA seqDB search
MTWSRRQFLTGVGVLAAVSGTAGRVVAKTLNINGVRYGMVHDESLCIGCTACMDACREVN
KVPEGVSRLTIIRSEPQGEFPDVKYRFFRKSCQHCDHAPCVDVCPTGASFRDAASGIVDV
NPDLCVGCQYCIAACPYRVRFIHPVTKTADKCDFCRKTHLQAGKLPACVEACPTKALTFG
NLDDPSSEISQLLRQKPTYRYKLALGTKPKLYRVPFKYGEVSQ
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacctggtcacgtcgccagtttctcaccggcgtcggtgtgctggccgccgtcagcggc
accgcaggacgcgtggtggcgaaaacgttgaatatcaatggtgtgcgttacggcatggtg
catgacgagtcgttatgcatcggctgtaccgcctgtatggatgcttgtcgggaagtgaac
aaggtgccggaaggcgtctcgcgcctgacgattattcgtagcgagccgcagggcgaattt
cctgatgtgaaatatcgcttcttccgtaagtcttgccagcactgcgatcatgcgccgtgc
gttgatgtctgcccgaccggtgcgtcttttcgcgacgctgccagtgggattgtcgatgtt
aatccggatctctgcgtcggttgtcagtactgcatcgccgcctgtccgtaccgcgtgcgc
tttatccatccggtcacgaagacggcggacaaatgcgatttctgccgtaagacccatttg
caggccggtaagctgcccgcgtgcgttgaggcttgcccgacgaaggcgctgacgtttggc
aatctggacgatcccagcagtgagatttcgcaactgctgcgccagaagcccacttaccgc
tacaagctggcgctgggaaccaaaccgaagctgtaccgcgtaccgtttaaatacggggag
gtgagccaatga

DBGET integrated database retrieval system