KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_242Help
Entry
APECO1_242        CDS       T00425                                 

Gene name
ybcS2
Definition
bacteriophage lambda lysozyme-like protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1195815..1196312
Genome map
AA seq 165 aa AA seqDB search
MPPSLRKAVAAAIGGGAIAIASVLITGPSGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
MLGKTYTKAECKALLNKDLATVARQINPYIKVDIPETMRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREICLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatcattacgaaaagccgttgctgctgctattggtggcggagcaattgctata
gcatcagtgttaatcactggcccaagtggtaacgatggtctggaaggtgtcagctacata
ccatacaaagatattgttggtgtatggactgtatgtcacgggcatacaggaaaagacatc
atgctcggtaaaacgtataccaaagcagaatgcaaagccctcctgaataaagaccttgcc
acggtcgccagacaaattaacccgtacatcaaagtcgatataccggaaacaatgcgcggc
gctctttactcattcgtttacaacgtgggtgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatgtgatcagctacgtcgctggacatat
gctggcggtaagcaatggaaaggtctcatgactcgtcgtgagattgagcgtgaaatctgt
ttgtggggtcagcaatga

DBGET integrated database retrieval system