KEGG   Escherichia coli APEC O1 (APEC): APECO1_2461Help
Entry
APECO1_2461       CDS       T00425                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APECO1_2461 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    APECO1_2461 (aceA)
Enzymes [BR:ecv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     APECO1_2461 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4537622..4538941
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWR
LLHGESKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPAN
SVPAVVERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDA
DAADLITSDCDPHDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDL
ELARRFAQAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKFQFITLAGI
HSMWFNMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTII
QGGTSSVTALTGSTEESQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtacacaacaaattgaagaattacagaaagagtgg
actcaaccgcgttgggaaggcattactcgcccgtacagcgcggaagatgtggtgaaatta
cgcggttcagtcaatccggaatgcaccctggcgcaactgggcgcggcgaaaatgtggcgt
ctgctgcacggcgagtcgaaaaaaggctacatcaacagcctcggtgcactgactggtggt
caggcgctgcaacaggcgaaagcgggtattgaagcagtctatctgtcgggatggcaggta
gcggcggacgctaacctggcggccagcatgtatccggatcagtcgctctatccggcaaac
tcggtgccagcggtggtggagcggatcaacaatactttccgccgtgcggatcagatccaa
tggtccgcgggcattgagccgggcgatccgcgctatgtcgattacttcctgccgatcgtc
gccgatgcggaggccggttttggcggtgtactgaatgcctttgaactgatgaaagcgatg
attgaagccggtgcagcggcagttcacttcgaagatcagctggcatcagtgaagaaatgt
ggtcacatgggcggcaaagttttggtgccaactcaggaagctattcagaaactggtcgcg
gcgcgtctggcagctgatgtgacgggcgttccaaccctgctggttgctcgtaccgatgcc
gatgcggcggatctgattacctccgattgcgacccacatgacagcgaatttattactggc
gagcgtaccagtgaaggcttcttccgtactcatgcgggtattgagcaagcgatcagccgt
ggcctggcgtatgcgccatatgctgacctggtatggtgtgaaacctccacgccggacctg
gaactggcgcgtcgctttgcacaagccatccacgcgaaatatccgggcaaactgctggct
tataactgctcgccgtcgttcaactggcagaaaaacctcgacgacaaaactattgccagc
ttccagcagcagctgtcggatatgggctacaagttccagttcatcaccctggcaggtatc
cacagcatgtggttcaacatgtttgacctggcaaacgcctatgcccagggcgagggtatg
aagcactatgttgagaaagtgcagcagccggaatttgccgccgcgaaagatggctatacc
ttcgtatctcaccagcaggaagtgggtacaggttacttcgataaagtgacgaccattatt
cagggcggcacgtcgtcggttaccgcactgactggctccactgaagaatcgcagttctaa

DBGET integrated database retrieval system