KEGG   Escherichia coli APEC O1 (APEC): APECO1_2462Help
Entry
APECO1_2462       CDS       T00425                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APECO1_2462 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    APECO1_2462 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    APECO1_2462 (aceB)
Enzymes [BR:ecv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     APECO1_2462 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4535988..4537607
Genome map
AA seq 539 aa AA seqDB search
MTRSCTMTEQATTIDELAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQ
QQDIDNGMLPDFISETASIRDADWKIRGIPSDLEDRRVEITGPVERKMVINALNANVKVF
MADFEDSLAPDWNKVIDGQINLRDAVNGTISYSNEAGKIYQLKPNPAVLICRVRGLHLPE
KHVTWRGETIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAED
RFNLPRGTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRV
LPDRQAVTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEERNNQVLDKVKADKS
LEANNGHDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCDGERT
EEGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPV
TKALFRQMLGEEMKVIASELGEERFSHGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggagctgcacgatgactgaacaggcaacaacaatcgatgaactggcttttaca
aggccgtatggcgagcaggagaagcaaattcttactgccgaagcggtagaatttctgact
gagctggtgacgcattttacgccacaacgcaataaacttctggcagcgcgtattcagcag
cagcaggatatcgataacggaatgttgcctgattttatttcggaaacagcttccattcgt
gatgctgactggaaaattcgcgggattccttcggacttagaagatcgtcgcgtagagatt
accggacctgtagagcgcaagatggtgatcaacgcgctcaacgccaatgtgaaagtcttt
atggccgatttcgaagattcactggcaccagactggaacaaagtgatcgatgggcaaatt
aacctgcgcgatgcggttaacggcaccatcagctatagcaatgaagcaggcaaaatttat
cagctcaagcccaatccagcggttttgatttgtcgggtacgcggtctgcacttgccggaa
aaacatgtcacctggcgtggtgagacaatccccggtagcctgtttgattttgcgctctat
ttcttccacaactatcaggcactgttggcaaagggcagcggtccctatttctatctgccg
aaaacccagtcctggcaggaagcggcctggtggagcgaagtcttcagctatgcagaagat
cgctttaatctgccgcgcggcaccatcaaggcgacgttgctgattgaaacgctgcccgcc
gtgttccagatggatgaaatccttcacgcgctgcgtgaccatattgttggtctgaactgc
ggtcgttgggattacatcttcagttatatcaaaacattgaaaaactatcccgatcgcgtc
ctgccagacagacaggcagtgacgatggataaacccttcctgaatgcttactcacgcctg
ttgattaaaacctgccataaacgcggtgcttttgcgatgggcggcatggcggcgtttatt
ccaagcaaagatgaagagcgcaataaccaggtgctcgacaaagtaaaagcggataaatcg
ctggaagccaataacggtcacgatggcacatggatcgctcacccgggccttgctgatacg
gcaatggcggtattcaacgatattctcggctcccgcaaaaaccagcttgaggtgatgcgc
gaacaagacgcgccgattactgccgatcagctgctggcaccttgtgatggtgaacgcacc
gaagaaggtatgcgcgccaacattcgcgtggctgtgcagtacatcgaagcgtggatctct
ggcaatggctgtgtgccgatttatggcctgatggaagatgcggcgacggctgaaatttcc
cgtacctcaatctggcagtggatccatcatcaaaaaacgttgagcaatggcaaaccggtg
actaaagccttgttccgccagatgctgggcgaagagatgaaagtcattgccagcgaactg
ggcgaagaacgtttctcccatgggcgttttgacgatgccgcacgcttgatggaacagatc
accacttccgatgagttaattgatttcctgaccctgccaggctaccgcctgttagcgtaa

DBGET integrated database retrieval system