KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_2462Help
Entry
APECO1_2462       CDS       T00425                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ecv01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ecv00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ecv00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4535988..4537607
Genome map
AA seq 539 aa AA seqDB search
MTRSCTMTEQATTIDELAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQ
QQDIDNGMLPDFISETASIRDADWKIRGIPSDLEDRRVEITGPVERKMVINALNANVKVF
MADFEDSLAPDWNKVIDGQINLRDAVNGTISYSNEAGKIYQLKPNPAVLICRVRGLHLPE
KHVTWRGETIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAED
RFNLPRGTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRV
LPDRQAVTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEERNNQVLDKVKADKS
LEANNGHDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCDGERT
EEGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPV
TKALFRQMLGEEMKVIASELGEERFSHGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggagctgcacgatgactgaacaggcaacaacaatcgatgaactggcttttaca
aggccgtatggcgagcaggagaagcaaattcttactgccgaagcggtagaatttctgact
gagctggtgacgcattttacgccacaacgcaataaacttctggcagcgcgtattcagcag
cagcaggatatcgataacggaatgttgcctgattttatttcggaaacagcttccattcgt
gatgctgactggaaaattcgcgggattccttcggacttagaagatcgtcgcgtagagatt
accggacctgtagagcgcaagatggtgatcaacgcgctcaacgccaatgtgaaagtcttt
atggccgatttcgaagattcactggcaccagactggaacaaagtgatcgatgggcaaatt
aacctgcgcgatgcggttaacggcaccatcagctatagcaatgaagcaggcaaaatttat
cagctcaagcccaatccagcggttttgatttgtcgggtacgcggtctgcacttgccggaa
aaacatgtcacctggcgtggtgagacaatccccggtagcctgtttgattttgcgctctat
ttcttccacaactatcaggcactgttggcaaagggcagcggtccctatttctatctgccg
aaaacccagtcctggcaggaagcggcctggtggagcgaagtcttcagctatgcagaagat
cgctttaatctgccgcgcggcaccatcaaggcgacgttgctgattgaaacgctgcccgcc
gtgttccagatggatgaaatccttcacgcgctgcgtgaccatattgttggtctgaactgc
ggtcgttgggattacatcttcagttatatcaaaacattgaaaaactatcccgatcgcgtc
ctgccagacagacaggcagtgacgatggataaacccttcctgaatgcttactcacgcctg
ttgattaaaacctgccataaacgcggtgcttttgcgatgggcggcatggcggcgtttatt
ccaagcaaagatgaagagcgcaataaccaggtgctcgacaaagtaaaagcggataaatcg
ctggaagccaataacggtcacgatggcacatggatcgctcacccgggccttgctgatacg
gcaatggcggtattcaacgatattctcggctcccgcaaaaaccagcttgaggtgatgcgc
gaacaagacgcgccgattactgccgatcagctgctggcaccttgtgatggtgaacgcacc
gaagaaggtatgcgcgccaacattcgcgtggctgtgcagtacatcgaagcgtggatctct
ggcaatggctgtgtgccgatttatggcctgatggaagatgcggcgacggctgaaatttcc
cgtacctcaatctggcagtggatccatcatcaaaaaacgttgagcaatggcaaaccggtg
actaaagccttgttccgccagatgctgggcgaagagatgaaagtcattgccagcgaactg
ggcgaagaacgtttctcccatgggcgttttgacgatgccgcacgcttgatggaacagatc
accacttccgatgagttaattgatttcctgaccctgccaggctaccgcctgttagcgtaa

DBGET integrated database retrieval system