KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_2543Help
Entry
APECO1_2543       CDS       T00425                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ecv00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4424726..4426255)
Genome map
AA seq 509 aa AA seqDB search
MTTGQLNMTEKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEI
WATQSSTLVEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEIC
EHLKRDGLEDYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWK
MTQGRVHVTDYTNASRTMLFNIHTLDWDDKMLEVLDIPREMLPEVRRSSEVYGQTNIGGK
GGTRIPISGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIAC
GPTGEVNYALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLG
APYWDPYARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGA
VANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRP
GIETTERNYRYAGWKKAVKRAMAWEEHDE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgactacgggacaattaaacatgactgaaaaaaaatatatcgttgcgctcgaccagggc
accaccagctcccgcgcggtcgtaatggatcacgatgccaatatcattagcgtgtcgcag
cgcgaatttgagcaaatctacccaaaaccaggctgggtagaacacgacccaatggaaatc
tgggccacccaaagctccacgctggtagaagtgctggcgaaagccgatatcagttccgat
cagattgcagctatcggtattacgaaccagcgtgaaaccactattgtctgggaaaaagaa
accggcaagcctatctataacgccattgtctggcagtgccgtcgtaccgcagaaatctgc
gagcatttaaaacgtgacggtttagaagattatatccgcagcaataccggtctggtgatt
gacccgtatttctctggcaccaaagtgaagtggatcctcgaccatgtggaaggctctcgc
gagcgtgcgcgtcgtggtgaattgctgtttggtacggttgatacgtggcttatctggaaa
atgactcagggccgtgtccatgtgaccgattacaccaacgcctctcgtaccatgttgttc
aacatccataccctggactgggacgacaaaatgctggaggtgctggatattccgcgtgag
atgctgccagaagtgcgtcgttcttccgaagtatacggtcagactaacattggcggcaaa
ggcggcacgcgtattccaatctccgggatcgccggtgaccagcaggccgcgctgtttggt
cagttgtgcgtgaaagaagggatggcgaagaatacctacggcactggctgctttatgctg
atgaacaccggcgagaaagcggtgaaatcagaaaacggcctgctgaccaccatcgcctgc
ggcccgactggcgaagtgaactatgcgctggaaggtgcagtgtttatggcgggcgcgtcc
attcagtggctgcgcgatgagatgaagttgattaacgacgcctacgattccgaatatttc
gccaccaaagtgcaaaacaccaatggtgtgtatgtggttccggcctttaccgggctgggt
gcgccatactgggatccgtatgcacgcggggcgattttcggtctgactcgtggggtgaac
gctaaccacattatacgcgcgacgctggagtctattgcttatcagacgcgtgacgtgctg
gaagcaatgcaggccgactccggtattcgtctgcacgcgctgcgcgtggacggcggtgcg
gtggcgaacaatttcctgatgcagttccagtccgatattctcggtacgcgcgttgagcgc
ccggaagtgcgcgaagtcaccgctttgggtgcggcctatcttgctggtctggcggttggc
ttctggcagaatcttgacgagctgcaagagaaagcggtgattgaacgcgagttccgtcca
ggcatcgaaaccactgagcgtaattaccgttacgcaggctggaaaaaagcggtcaaacgc
gcgatggcatgggaagaacacgacgagtaa

DBGET integrated database retrieval system