KEGG   Escherichia coli APEC O1 (APEC): APECO1_2611Help
Entry
APECO1_2611       CDS       T00425                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APECO1_2611 (fadB)
   01212 Fatty acid metabolism
    APECO1_2611 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    APECO1_2611 (fadB)
   00650 Butanoate metabolism
    APECO1_2611 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    APECO1_2611 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    APECO1_2611 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APECO1_2611 (fadB)
   00310 Lysine degradation
    APECO1_2611 (fadB)
   00380 Tryptophan metabolism
    APECO1_2611 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    APECO1_2611 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    APECO1_2611 (fadB)
   00281 Geraniol degradation
    APECO1_2611 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    APECO1_2611 (fadB)
Enzymes [BR:ecv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     APECO1_2611 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     APECO1_2611 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     APECO1_2611 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     APECO1_2611 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4347126..4349441)
Genome map
AA seq 771 aa AA seqDB search
MISAERDQIGISLIFYLHIFNTKYTLRCIWYDQITLRIQETDMLYKGDTLYLDWLEDGIA
ELVFDTPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSNKAAFIVGADITEFLSLFL
VPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLP
ETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAI
AILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGMVAQTAGKHYPAPITAVKTI
EAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVKGKAKKLTKDVETPKQAAV
LGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLLNKQLERGKIDGLKLAGVI
STIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRPDTVLASNTSTIPISELAN
ALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAWASKMGKTPIVVNDCPGFF
VNRVLFPYFAGFSQLLRDGAGFRKIDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAA
GFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKPKKEEDVVVDDLLAKVSQP
KRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVYGLGFPPFHGGAFRWLDTL
GSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPARPVGDLKTA
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctgccgagcgtgatcagatcggcatttccttaatattttatttgcatattttt
aacacaaaatacacacttcgatgcatctggtacgaccagatcaccttgcggattcaggag
actgacatgctttacaaaggcgacaccctttaccttgactggctggaagatggcattgcc
gaactggtatttgataccccaggttcagttaataaactcgacactgcgaccgtcgccagc
ctcggcgaggccatcggcgtgctggaacagcaatcagatctaaaaggactgctgctacgt
tcgaacaaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctc
gttcctgaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctg
gaagatctgccggtgccgaccattgctgccgtcaacggctatgcgctgggcggtggctgc
gaatgcgtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccg
gaaaccaaattgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctg
ggcgctgacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcg
ctgaaaatcggtctggtggatggcgtagtcaaagcagaaaaactggttgaaggggcgata
gcgattttacgccaggccattaacggcgacctcgactggaaagcaaaacgtcagccgaag
ctggaaccgctaaaactgagcaagattgaagccgccatgagcttcaccatcgctaaaggg
atggtcgcgcaaacggcggggaaacattatccggcccccatcaccgcagtaaaaaccatt
gaagctgcggcccgttttggtcgtgaagaagccttaaacctggaaaacaaaagttttgtc
ccgctggcgcataccaacgaagcccgcgcactggtcggcattttccttaacgatcaatat
gtaaaaggtaaagcgaagaaactcaccaaagatgttgaaaccccgaaacaggccgctgtg
ctgggcgcaggcattatgggcggcggcatcgcctaccagtctgcgtggaaaggcgtgccg
gttgtcatgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaa
ctgctgaacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatc
tccacaattcacccaacgctcgactacgccgggtttgaccgcgtggatgttgtggtagaa
gcggttgttgaaaacccgaaagtgaaaaaagccgtgctggcagaaaccgagcagaaagta
cgcccggataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaac
gcgctggaacgtccggaaaacttctgcgggatgcacttctttaacccggtgcaccggatg
ccgttggtggaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagtcgtc
gcctgggcgagcaagatgggcaagacgccgattgtggtcaacgactgccccggcttcttc
gtcaaccgtgtgctgttcccctatttcgccggtttcagccagttgctgcgcgacggcgcg
ggtttccgcaagatcgacaaagtgatggaaaaacagtttggctggccgatgggtccggca
tatctgctggatgttgtgggcattgacaccgcgcatcacgctcaggctgtcatggcagca
ggcttcccgcagcggatgcagaaagattatcgcgatgccatcgacgcgctgtttgatgcc
aaccgctttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggt
aagccgaagaaagaagaagatgtcgtcgttgacgacctgctggcaaaagtgagccagccg
aagcgcgatttcagcgaggaagagattatcgcccgcatgatgatcccgatggtcaacgaa
gtggtccgctgtctggaagagggcattatcgccactccggcagaagcggatatggcgctg
gtctacggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctc
ggcagcgcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtatgaa
gtaccggaaggtctgcgtaataaagcacgtcataacgaaccgtactatcccccggttgag
ccagcccgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system