KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_2930Help
Entry
APECO1_2930       CDS       T00425                                 

Gene name
yhjA
Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3967363..3968760)
Genome map
AA seq 465 aa AA seqDB search
MKMVSRITAIGLAGVAICYLGLSGYVWYHDNKRSKQADVQASAVSENNKVLGFLREKGCD
YCHTPSAELPAYYYIPGAKQLMDYDIKLGYKSFNLEAVRAALLANKPVSQSDLNKIEWVM
QYETMPPTRYTALHWAGKVSDEERAEILAWIAKQRAEYYASNDTAPEHRNEPVQPIPQKL
PTDAQKVALGFALYHDPRLSADSTISCAHCHALNAGGVDSRKTSIGVGGAVGPINAPTVF
NSVFNVEQFWDGRAATLQDQAGGPPLNPIEMASKSWDEIIAKLEKDPQLKAQFLEVYPQG
FSGENITDAIAEFEKTLITPDSPFDKWLRGDENALTAQQKKGYQLFKDNKCATCHGGIIL
GGRSFEPLGLKKDFNFGEITAADIGRMNVTKEERDKLRQKVPGLRNVALTAPYFHRGDVP
TLDGAVKLMLRYQVGKELPQEDVDDIVAFLHSLNGVYTPYMQDKQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggtctcacgtattaccgcgatcggcctggctggcgtcgcgatttgctattta
gggttatctggttatgtgtggtaccacgataataaacgcagtaaacaggccgatgttcag
gcatctgctgtcagtgaaaataataaggttttaggctttctccgcgaaaaaggatgcgat
tattgccatacgccttcggcagaattacctgcctattattatattcccggcgcgaaacag
ttgatggattacgacataaagcttggatataaatcttttaacctcgaggccgtgcgtgcg
gctctgctggctaataaacccgtttcgcaaagcgatctgaataagattgaatgggtgatg
cagtatgaaactatgccgccaacgcgttataccgcgcttcactgggcgggtaaggtgagt
gatgaagagcgggcggaaatactggcctggattgcaaaacagcgcgcggaatattacgcc
agcaatgatactgctccggagcatcgcaatgaaccggtgcagcccatcccgcaaaaactg
cctaccgatgcgcaaaaagtggcgttgggttttgcgctgtatcacgatccccgtttatcg
gctgatagcaccatttcatgcgctcattgccatgcgttgaatgcggggggcgtcgatagc
agaaaaacatcgattggtgttggtggcgcagttgggccgattaacgcgccgacggtattt
aactcagtatttaacgttgagcagttctgggatggtcgtgcggcaacattgcaggatcag
gctggtggaccgccgttgaacccgattgaaatggcgtcgaaatcctgggacgaaattatt
gctaagctggaaaaagatccgcagcttaaagcgcagttcctcgaagtctatccgcaaggt
ttcagtggcgaaaatattactgatgccattgctgaatttgagaaaacattaattacgccg
gattccccatttgataaatggttgcgtggagatgagaatgctctgacggcgcaacagaaa
aaaggctatcaattatttaaagataataaatgtgcaacttgtcatggtggtattattctc
ggcggacgttcctttgaaccgttggggctgaaaaaagactttaactttggtgaaattacg
gcggcggatattggtcgtatgaatgttactaaagaagagcgtgataaattgcgtcagaaa
gtacccggtttacgtaacgttgctttaacggcaccgtacttccatcgcggtgacgtgccg
acgctggacggggcggtgaaactgatgctgcgctatcaggtaggcaaagagctgccgcag
gaggatgtggatgatatcgtcgctttcctgcacagtctgaacggggtttacacgccgtat
atgcaggataaacaataa

DBGET integrated database retrieval system