KEGG   Escherichia coli APEC O1 (APEC): APECO1_3050Help
Entry
APECO1_3050       CDS       T00425                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    APECO1_3050 (malQ)
Enzymes [BR:ecv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     APECO1_3050 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3833566..3835650)
Genome map
AA seq 694 aa AA seqDB search
MESKRLDNAALAAGISPNYINAHGKPQSISAETKRRLLDAMHQRTATKVAVTPVPNVMVY
TSGKKMPMVVEGSGEYSWLLTTEEGTQYKGHVTGGKAFNLPTKLPEGYHTLTLTQDDQRA
HCRVIVAPKRCYEPQALLNKQKLWGACVQLYTLRSEKNWGIGDFGDLKAMLEDVAKRGGS
FIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFHLSEEAQAWWQLPTTQQT
LQQARDADWVDYSTVTTLKMTALRMAWKGFAQRDDEQMTAFRQFVAEQGDSLFWQAAFDA
LHAQQVKEDEMRWGWPAWPEMYQNVDSPEVRQFCEEHRDDVDFYLWLQWLAYSQFAACWE
ISQGYEMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDP
HIITARAYEPFIELLRANMQNCGALRIDHVMSMLRLWWIPYGETADQGAYVHYPVDDLLS
ILALESKRHRCMVIGEDLGTVPVEIVGKLRSSGVYSYKVLYFENDHEKTFRSPKAYPEQS
MAVAATHDLPTLRGYWESGDLTLGKTLGLYPDEVVLRGLYQDRELAKQGLLDALHKYGCL
PKRAGHKASLMSMTPTLNRGLQRYIADSNSALLGLQPEDWLDMAEPVNIPGTSYQYKNWR
RKLSATLETMFADDGVNKLLKDLDRRRRAAAKKK
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaacgtctggataatgccgcgctggcggcgggtattagccccaattacatc
aatgcccacggtaaaccgcagtcgattagcgccgaaaccaaacggcgtttgcttgacgcg
atgcatcaacgtaccgccacgaaagtggcggtaacgccagtcccgaatgtcatggtttat
accagcggcaaaaaaatgccgatggtggtggagggcagcggcgaatatagctggctgctg
accaccgaagaaggaacgcagtacaaaggccatgtaacggggggcaaagcgttcaatcta
ccgacgaagctgccggaaggttatcacacgctgacactcacccaggacgaccagcgcgcg
cattgccgggtgattgtcgccccgaaacgctgttacgaaccgcaggcgttgctgaataaa
caaaagctgtggggtgcctgcgttcagctttatacgctgcgatcggaaaaaaactggggt
attggggattttggcgatctcaaagcgatgcttgaggatgtggcaaaacgtggcgggtcg
ttcatcggtctgaacccgattcatgcgctctatccggcaaatccggaaagtgccagcccg
tacagcccgtcttctcgccgttggctgaatgtgatttatatcgacgttaacgcagttgaa
gatttccatcttagcgaagaggctcaggcctggtggcagttgccgaccacgcaacagacg
ctgcaacaggcgcgggatgccgactgggttgattactccacggttaccaccctaaaaatg
acagcattacgaatggcgtggaaaggtttcgcgcaacgtgatgatgagcagatgactgcg
tttcgccagtttgttgcagagcagggcgacagcctgttctggcaggcagcctttgatgcg
ctacatgcccagcaagtgaaagaggacgaaatgcgctggggctggccagcatggccagag
atgtatcagaacgtggattcaccagaagtgcgccagttctgcgaagaacatcgtgatgac
gtcgatttttatctctggttgcagtggctggcttacagccagtttgccgcctgctgggag
ataagccagggctatgaaatgccgattggcttgtatcgtgatctggccgttggtgtagca
gaaggtggggcagaaacctggtgcgaccgtgaactgtattgcctgaaagcgtcggttggc
gcgccgccggatatcctcggcccgttggggcagaactggggattgccgccaatggacccg
catatcatcaccgcgcgtgcctatgaaccgtttatcgagctgttgcgtgccaatatgcaa
aactgcggcgcattacgaattgatcacgtgatgtcgatgctgcgtttgtggtggataccg
tatggcgagacggcagatcagggcgcgtatgttcactatccggtggatgatctgctctcg
attctggcactcgaaagtaaacgtcatcgctgtatggtgattggtgaagatctcggtacc
gtaccggtagagattgtcggtaagctgcgcagcagcggtgtgtactcctacaaagtgctc
tatttcgaaaacgaccacgagaagacgttccgttcaccgaaagcgtacccggagcagtcg
atggcggttgcggcgacacacgacctgccaacgctgcgtggttactgggagagcggggat
ctaacgctgggcaaaaccctggggctgtatccggatgaagtggtactgcgcggtctgtat
caggatcgcgaactggcgaagcaagggctgctggatgcactgcataaatatggttgtctg
ccaaaacgtgccgggcataaggcatcgttgatgtcgatgacgccgacgctgaaccgtggt
ttgcagcgctacattgccgacagtaacagtgctctgttaggactacagccggaagactgg
ctggatatggccgaaccggtgaatattcctggcaccagttaccagtataaaaactggcga
cgcaagctttccgcaacgcttgagacgatgtttgccgatgatggcgtgaacaagttgctg
aaggatttggacagacggcgcagagctgcagcgaagaagaagtag

DBGET integrated database retrieval system