KEGG   Escherichia coli APEC O1 (APEC): APECO1_3115Help
Entry
APECO1_3115       CDS       T00425                                 

Gene name
yheB
Definition
bifunctional chitinase/lysozyme
Orthology
K13381  
bifunctional chitinase/lysozyme [EC:3.2.1.14 3.2.1.17]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    APECO1_3115 (yheB)
Enzymes [BR:ecv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     APECO1_3115 (yheB)
    3.2.1.17  lysozyme
     APECO1_3115 (yheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3757924..3760581)
Genome map
AA seq 885 aa AA seqDB search
MCSALPALAMEAWNNQQGGNKYQVIFDGKIYENAWWVSSTNCPGKAKANDATNPWRLKRT
ATAAEISQFGNTLSCEKSGSSSSSTSNTPASNTPANGASATPAQGTVPSNSSVVAWNKQQ
GGQTWYVVFNGAVYKNAWWVASSNCPGDAKGNDASNPWRYVRAATATEISETSNPQSCTS
APQPAPDVKPAPDVKPAPDVQPAPADKSNDNYAVVAWKGQEGSSTWYVIYNGGIYKNAWW
VGAANCPGDAKENDASNPWRYVRAATATEITQYGNPASCSVKPDNNGGAVTPVDPTPETP
ETPVTPTPDNNEPSTPADSSNDYSLQAWSGQEGSEIYHVIFNGNVYQNAWWVGSEDCPRG
TSVENSNNPWRLVRTATAAEMSQYGNPTTCEIDNGGVIIADGFQASKAYSANSIVDYNDA
HYKTSVDQDAWGFVPGGDNPWKKYEPAKAWSASTVYVKGDRVVVDGQAYEALFWTQSDNP
ALIANQNATGSNSRPWKPLGKTQSYSNEELNNAPQFNPETLYASDTLIRFNGENYISQSK
VQKVSPSDSNPWRVFVDWTGTKERVGTPKKAWPKHVYAPYVDFTLNTIPDLAALAKSHNV
NHFTLAFVVSKDANTCLPTWGTAYGMQNYAQYSKIKALREAGGDVMLSIGGANNAPLAAS
CKNVDDLMQHYYDIVDNLNLRVLDFDIEGTWVADQASIERRNLAVKKVQDKWKSEGKDIA
IWYTLPILPTGLTPEGMNVLSDAKAKGVELAGVNVMTMDYGNAICQSANTEGQNIHGKCA
TSAIANLHSQLKGLHPNKSDAEIDAMMGTTPMVGVNDVQGEVFYLSDARLVMQDAQKRNL
GMVGIWSIARDLPGGTNLSPEFHGLTKEQAPKYAFSEIFAPFTKQ
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
gtgtgttccgctctgccagcattggcaatggaagcatggaataaccaacaaggtggtaat
aaatatcaggttattttcgatggcaaaatttatgaaaatgcctggtgggtttcttctaca
aattgcccgggaaaagcgaaagcaaatgatgcaactaacccgtggcgtttaaagcgtacc
gcaacagctgctgaaattagtcagtttggcaatacactttcctgcgaaaagagcggaagc
tcatcttcttcaacttcaaatacgccagcatctaatacgcccgctaatggcgcttcggct
acaccagcacagggcactgttccgtctaattcttctgtagttgcctggaataaacagcag
ggcggtcaaacctggtatgtcgtctttaatggtgcggtatataaaaatgcttggtgggta
gcctcttctaactgcccgggtgatgcgaaaggcaatgatgccagcaacccatggcgttat
gttcgtgccgctacggcaacggaaatctcagaaaccagtaatccacagtcttgtacttca
gcaccacagcctgcaccggatgtgaaaccggcaccggacgttaaaccggctcctgatgtt
cagccagccccagctgataagtcaaacgacaactatgctgtcgtagcctggaaaggtcag
gaaggttcttctacatggtacgttatctacaacggcggcatttataagaacgcctggtgg
gtgggcgcggcaaattgcccaggcgatgcgaaagaaaacgatgccagcaacccatggcgt
tatgttcgcgcggcaacggcaacagaaatcactcagtatggtaacccagcctcctgttcc
gttaagccggataataatggcggtgctgtgactccggttgatccaactccggaaacaccg
gaaactccagttactccaactccggataacaacgagccatcaacaccagcggatagcagt
aacgattactcactgcaggcgtggagtggccaggaaggcagcgaaatttaccatgttatc
ttcaatggtaatgtttatcagaatgcctggtgggttggttctgaagattgcccgcgtggc
accagtgtagaaaactccaataacccatggcgcctcgtgcgtacagctaccgctgcggaa
atgagtcagtacggtaacccgactacctgtgaaattgataatggcggcgtcattattgcg
gatggtttccaggccagcaaagcgtacagcgcgaacagcatcgtagattataacgatgca
cattataaaacctctgtcgatcaagacgcatggggctttgtccccggcggcgataacccg
tggaagaaatacgaaccggcgaaagcatggtccgcttccaccgtgtacgtgaaaggtgat
cgcgttgttgttgatgggcaggcttatgaagcgctgttctggacgcaaagtgacaaccct
gctctgattgcgaaccaaaacgccaccggtagcaatagtcgcccgtggaagccgttaggt
aagactcagagctatagcaacgaagagctgaataatgcgccgcagtttaatccagaaacg
ctttatgccagtgatacgctgattcgctttaacggtgagaactacatttctcagagtaaa
gtgcagaaagtttctccttctgacagcaacccgtggcgtgtttttgttgactggaccgga
accaaagagcgcgtaggtacgccgaagaaagcgtggccgaaacacgtttatgcaccgtat
gtcgactttacgctgaatacgatcccggatttggctgcgctggctaagagtcataacgtc
aaccacttcacgctggcgtttgtggtgagtaaagatgcgaacacctgtctaccgacatgg
ggtaccgcttacggtatgcagaattacgctcagtacagcaaaatcaaagctctgcgtgag
gctggcggtgatgtgatgctgtctatcggtggtgctaataatgccccgctggcagcttcc
tgtaagaacgttgacgatctaatgcagcattattatgacatcgttgataacctgaacctc
agagtcctggacttcgatatcgaaggcacctgggttgcggatcaggcatctattgaacgt
cgtaaccttgctgtgaagaaagtgcaggataaatggaagtcagaaggcaaagatattgct
atctggtataccttgccaattctgccgacaggcctgacgccggaagggatgaatgtcctg
agcgatgccaaagcgaaaggtgttgagctggcgggtgtgaacgtgatgacaatggactac
ggtaacgcgatttgtcagtctgcaaataccgaaggccagaacattcacggtaagtgtgca
acgtctgcgattgccaacctgcattcacaattgaaaggcctccatcccaacaagagcgat
gcagaaattgacgctatgatgggtaccacgccgatggttggcgtgaacgacgttcagggc
gaggtgttctatctctctgatgctcgtctggtcatgcaggatgcgcagaagcgtaatctc
ggtatggttggtatctggtcaatcgcgcgcgacctgccaggcggcactaacctgtctccg
gaattccacggcctgactaaagaacaggcaccgaagtacgcatttagcgaaatcttcgcg
ccgtttactaagcaataa

DBGET integrated database retrieval system