KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_3340Help
Entry
APECO1_3340       CDS       T00425                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ecv00052]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ecv00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3523302..3526430
Genome map
AA seq 1042 aa AA seqDB search
MNGSDFSLPGGPMNRWENIQLTHENRLAPRAYFFSYDSVAQARTFARETSSLFLLLSGQW
NFHFFDHPLQVPEAFTSELMADWGHITVPAMWQMEGHGKLQYTDEGFPFPIDVPFVPSDN
PTGAYQRIFTLSDGWQGKQTLIKFDGVETYFEVYVNGQYVGFSKGSRLTAEFDISAMVKT
GDNLLCVRVMQWANSTYVEDLDMWWSAGIFRDVYLIGKQLTHINDFTVRTDFDEAYCDAT
LSCEVVLENLAASPVVTTLEYTLFDGEHVVHSSAIDHLAIEKLTSASFAFTVEQPQQWSA
ESPYLYHLVMTLKDADGNVLEVVPQRVGFRDIKVRDGLFWINNRYVMLHGVNRHDNDHRK
GRAVGMDRVEKDLQLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVESHGFANV
GDISRITDDPQWEKVYVERIVRHIHAQKNHPSIIIWSLGNESGYGCNIRAMYHAAKALDD
TRLVHYEEDRDAEVVDIISTMYTRVPLMNEFGEYPHPKPRIICEYAHAMGNGPGGLTEYQ
NVFYKHDCIQGHYVWEWCDHGIQAQDDNGNVWYKFGGDYGDYPNNYNFCLDGLIYSDQTP
GPGLKEYKQVIAPVKIHALDLTRGELKVENKLWFTTLDDYTLHAEVRAEGETLATQQIKL
RDVAPNSEAPLQITLPQLDAREAFLNITVTKDSRTRYSEAGHSIATYQFPLKENTAQPVP
FAPNNARPLTLEDDRLSCTVRGYNFAITFSKTSGKPTSWQVNGESLLTREPKINFFKPMI
DNHKQEYEGLWQPNHLQIMQEHLRDFVVEQSDDEVLLVSRTVIAPPVFDFGMRCTYIWRI
AADGQVNVALSGERYGDYPHIIPCIGFTMGINGEYDQVAYYGRGPGENYADSQQANIIDI
WRSTVDAMFENYPFPQNNGNRQHVRWTALTNRHGNGLLVVPQRPINFSAWHYTQENIHAA
QHCNELQRSDDITLNLDHQLLGLGSNSWGSEVLDSWRVWFRDFSYGFTLLPVSGGEATAQ
SLASYEFGAGFFSTNLHSENKQ
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgaatggttccgatttctctctaccgggaggccctatgaatcgctgggaaaacattcag
ctcacccacgaaaaccgacttgcgccgcgtgcgtactttttttcatatgattctgttgcg
caggctcgtacttttgcccgtgaaaccagcagcctgtttctgctcttaagcggtcagtgg
aatttccacttttttgaccatccgctgcaagtgccagaagccttcacctctgagttaatg
gctgactgggggcatattaccgtccccgccatgtggcaaatggaaggtcacggcaaactg
caatataccgacgaaggttttccgttccccatcgatgtgccgtttgtccccagcgataac
ccaaccggtgcctatcaacgtattttcaccctcagcgacggctggcagggtaaacagacg
ctgattaaatttgacggcgtcgaaacctattttgaagtctacgttaacggtcagtatgtg
gggttcagcaagggcagtcgcctgaccgcagagtttgacatcagcgcgatggttaaaacc
ggcgacaacctgttgtgtgtgcgtgtgatgcaatgggcgaactctacctacgtggaagac
ctggatatgtggtggtcggcggggattttccgcgatgtttatctgatcggaaaacaactc
acgcatattaacgatttcaccgttcgtaccgactttgacgaagcctattgcgatgccaca
ctttcctgcgaagtggtgctggaaaatctcgccgcctcccctgtcgtcacgacgctggaa
tataccctgtttgatggcgaacacgtggtgcacagcagcgccattgatcatttggcaatt
gaaaaactgaccagcgccagttttgcttttactgtcgaacagccgcagcaatggtcagca
gaatccccttatctttaccatctggtcatgacgctgaaagacgccgacggcaacgttctg
gaagtggtgccacaacgcgttggcttccgtgatatcaaagtgcgcgacggtctgttctgg
atcaataaccgttatgtgatgctgcatggcgtcaaccgccacgacaacgatcatcgcaaa
ggccgcgccgttgggatggatcgcgtcgagaaagatctccagttgatgaagcagcacaac
atcaactccgtgcgtaccgctcactacccgaacgatccacgtttttacgaactgtgcgat
atctacggcctgtttgtgatggcggaaaccgacgtcgaatcgcacggctttgctaatgtc
ggcgatatcagccgtattaccgacgatccgcagtgggaaaaagtctacgtcgagcgcatt
gttcgccatattcacgcgcagaaaaaccatccgtcgatcatcatctggtcgctgggcaat
gaatccggctatggctgtaacatccgcgcgatgtaccatgcggcgaaggcgctggatgac
acgcgactggtgcattacgaagaagatcgcgatgctgaagtggtcgatattatttccacc
atgtacacccgcgtgcctctgatgaatgagtttggtgaatacccgcatccgaagccgcgc
atcatctgtgaatatgctcatgcgatggggaacggaccgggcgggctgacggagtaccag
aacgtcttctataagcacgattgcattcagggacattatgtctgggaatggtgcgaccac
gggatccaggcgcaggatgacaacggcaacgtctggtacaaattcggcggcgactacggc
gactatcccaacaactataacttctgtcttgatggtttgatctattccgatcagacgccg
ggaccaggcctgaaagagtacaaacaggttattgcgccggtaaaaatccacgcgctggat
ctgactcgcggcgagttgaaagtcgaaaataaactgtggtttaccacgcttgatgactac
accctgcacgcagaggtgcgcgccgaaggtgaaacgctcgcgacgcaacagattaaactg
cgcgacgttgcgccgaacagcgaagcccccttacagatcacgctgccgcagctggacgcc
cgcgaagcgttcctcaacattacggtgaccaaagattcccgcacccgctacagcgaagcc
gggcattctatcgccacttatcagttcccgctgaaggaaaacaccgcgcagcctgtacct
ttcgcaccgaataacgcccgtccgctgacgctggaagacgatcgtttgagctgtactgtt
cgcggctacaactttgcgatcaccttctcaaaaacgagtggtaaaccgacatcctggcaa
gtgaatggcgagtcgctgctgacccgcgagccaaagatcaacttcttcaagccgatgatc
gacaaccataagcaggagtacgaagggctgtggcagccaaatcatttgcagatcatgcag
gagcatctgcgcgattttgtcgttgagcaaagtgatgatgaagtgttgctagtcagccgc
acggttattgccccaccggtgtttgacttcgggatgcgctgcacctacatctggcgcatc
gctgccgatggccaggttaatgtggcgctttccggtgaacgttatggcgactatccgcac
atcattccgtgcatcggtttcaccatgggaattaacggcgaatacgaccaggtggcgtat
tacggacgtggaccgggcgaaaactacgccgacagccagcaggctaacatcattgatatc
tggcgcagtaccgtcgatgccatgttcgagaactatcccttcccgcagaacaacggcaac
cgtcagcatgtccgctggacggcactgactaatcgccacggcaacggtctgctggtggtt
ccgcagcgaccaattaacttcagcgcctggcactatacccaggaaaacatccacgctgca
cagcactgtaacgagcttcagcgcagtgatgacatcaccctgaatctcgaccaccagttg
cttggcctcggctctaactcctggggcagcgaggtgctggactcctggcgcgtctggttc
cgtgacttcagctacggctttacgttgctgccggtttctggcggagaagctaccgcgcaa
agcctggcgtcgtatgagttcggcgcagggttcttttccacgaatttgcacagcgagaat
aagcaatga

DBGET integrated database retrieval system