KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_3626Help
Entry
APECO1_3626       CDS       T00425                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ecv00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3239304..3240743
Genome map
AA seq 479 aa AA seqDB search
MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVVPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMIDE
LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAAHRINPEMKVGC
MLAMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGD
LDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQKPLFIVENGFGAYDKVEDDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM
GYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGENL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgct
catcaggtcgaaggcggctggaacaaaggcggcaaagggccgagcatttgtgacgttctg
accggtggcgcacacggcgtgccgcgcgaaatcaccaaagaagttgtgcctggcaaatac
tatccaaaccatgaagccgttgatttttatggtcactacaaggaggacatcaagctattt
gccgaaatgggcttcaaatgttttcgtacttccatcgcctggacgcgcatttttccaaaa
ggcgatgaagctcagccaaacgaagaagggctgaagttctacgatgatatgatcgatgaa
ctgctgaaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcat
ctggtgcagcaatatggtagctggaccaaccgtaaagtggttgatttctttgtccgtttc
gcggaagtggtatttgaacgctataagcataaagtcaaatactggatgaccttcaacgaa
attaacaaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtg
tataccgagcatgaaaacccggaagagacgatgtatcaggtgctgcatcaccagtttgtc
gccagcgccctggcggtgaaagccgcgcatcgcatcaacccggagatgaaagtcggttgt
atgctggcgatggtgccgctctatccttactcctgtaacccggacgatgtgatgtttgcc
caggagtcgatgcgcgaacgttacgtctttaccgatgtgcagttgcgtggctattacccg
tcctatgtgttgaacgagtgggaacgccgcggatttaacatcaaaatggaagacggcgat
ctggatgtactgcgcgaaggcacctgcgattatctcggcttcagctattacatgaccaac
gcggtgaaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtaccg
aacccgtatgttaaagcgtctgactggggctggcagattgatccggttggtctgcgttac
gcgctttgcgagctgtatgagcgttaccagaagccgctgtttattgtcgaaaacggtttt
ggcgcttacgacaaagtggaagatgatggcagcatcaatgacgattaccgcattgactac
ctgcgcgcccatattgaagagatgaaaaaagcggtgacttacgatggcgtggacctgatg
ggctacacgccgtggggctgcatcgactgtgtgtcgttcaccaccgggcagtacagcaaa
cgctacggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttca
cgtaagaagagctttaactggtacaaagaggtgattgccagcaacggcgagaatctgtaa

DBGET integrated database retrieval system