KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_3729Help
Entry
APECO1_3729       CDS       T00425                                 

Gene name
fucI
Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ecv00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3104596..3106371
Genome map
AA seq 591 aa AA seqDB search
MKKISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALLTEKLRHACGAAVECVISDT
CIAGMAEAAACEEKFSSQNVGLTITVTPCWCYGSETIDMDPTRPKAIWGFNGTERPGAVY
LAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLSL
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRY
GEDENNKQYQRNAEQSRAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEAILNSSFDWNGVRKPFVVATENDSLNGVAMLMGHQLTGTAQVFA
DVRTYWSPEAIERVTGHKLDGLAEHGIIHLINSGSAALDGSCKQRDSEGKPTMKPHWEIS
QQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS
VELPKDVHDILNKRTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADF
ITLASMLRIPVCMHNVEETKVYRPSAWAAHGMDIEGQDYRACQNYGPLYKR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagcttaccgaaaattggtatccgcccggttattgacggtcgtcgcatg
ggtgttcgtgagtcgcttgaagaacaaacaatgaatatggcgaaagccacggctgcactg
ctgaccgagaaactgcgccatgcctgcggagctgccgtcgagtgtgtcatttccgatacc
tgtatcgcgggtatggctgaagccgctgcttgcgaagaaaaattcagcagtcagaatgta
ggcctcaccattacggtaaccccttgctggtgctatggcagtgaaaccatcgacatggat
ccaacccgcccgaaagccatttggggctttaacggcactgaacgtcccggcgctgtttac
ctggcagcggctctggcagctcacagccagaaaggcatcccggcattctccatttacggt
catgacgttcaggatgccgatgacacatcgattcctgccgatgttgaagaaaaactgctg
cgctttgcccgcgccggtttagcagtcgccagcatgaaaggtaaaagctatctgtcgctg
ggcggcgtttcgatgggtatcgccggttccatcgttgatcataacttctttgaatcctgg
ctgggaatgaaagtccaggcggtggatatgaccgaactgcgtcgccgtatcgatcagaag
atttacgacgaagccgaactggaaatggcgctggcctgggctgataaaaacttccgctat
ggcgaagatgaaaataacaaacagtatcaacgcaatgccgagcaaagccgcgcagttctg
cgcgaaagtttactgatggcgatgtgtatccgcgacatgatgcaaggcaacagcaaactg
gccgatattggtcgcgtggaagaatcacttggctacaacgccatcgctgcaggcttccag
gggcaacgtcactggaccgatcaatatcccaatggcgataccgctgaagcgatcctcaac
agttcatttgactggaatggcgtgcgcaaaccgtttgtcgtggcgaccgaaaacgacagt
cttaacggcgtggcaatgttaatgggccaccagctcaccggcaccgctcaggtatttgcc
gatgtccgtacctactggtcaccagaagcaattgagcgtgtaacggggcataaactggac
gggctggcagaacacggcatcatccatttgatcaactccggttctgctgcgctggacggt
tcctgtaaacaacgcgacagcgaaggtaaaccgacgatgaagccgcactgggaaatctct
cagcaagaggctgacgcttgcctcgccgctaccgaatggtgcccggcgatccacgaatac
ttccgtggcggcggttactcttcccgctttcttaccgaaggcggcgtcccgttcaccatg
actcgtgtcaacatcatcaaaggcctgggaccggtactgcaaatcgcggaaggctggagc
gtggaattgccgaaggatgtgcatgacatcctcaacaaacgcaccaactcaacctggcca
accacctggtttgcaccgcgcctcaccggtaaagggccgtttacggatgtgtactcggta
atggcgaactggggcgctaaccacggggttctgaccatcggccacgttggcgcagacttt
atcactcttgcctccatgctgcgtatcccggtatgtatgcacaacgttgaagagaccaaa
gtgtatcgtccttctgcctgggccgcgcacggcatggatattgaaggccaggattaccgc
gcttgccagaactacggcccgttgtacaagcgttaa

DBGET integrated database retrieval system