KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_3780Help
Entry
APECO1_3780       CDS       T00425                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3045655..3046281)
Genome map
AA seq 208 aa AA seqDB search
MVSRRVQALLDQLRAQGIQDELVLNALAAVPREKFVDEAFEQKAWDNIALPIGQGQTISQ
PYMVARMTELLELTPQSRVLEIGTGSGYQTAILAHLVQHVCSVERIKGLQWQARRRLKNL
DLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALMTQLDEGGILVLPVGEEHQYLK
RVRRRGGEFIIDTVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcagacgcgtacaagcacttctggatcaattacgtgcgcaaggtattcaggat
gagctggtgctgaatgcacttgccgccgtgccgcgtgaaaaattcgttgatgaagcgttt
gaacaaaaagcctgggacaatatcgccttgccgataggtcaggggcagacaatttcgcag
ccgtatatggtggcgcgaatgaccgaattactcgagctgacgccgcagtcgcgggtgctg
gaaattggcactggttcgggatatcaaactgcaatcctggcgcatcttgtccaacatgtt
tgctcggttgaacggattaaaggcttgcagtggcaggcgcgtcgccgcctgaaaaatctt
gatttacataatgtttcaacccgtcatggcgatggatggcaaggttggcaggcacgcgcg
ccgtttgacgctatcattgttacggcggcaccgcctgaaattccaactgcgctaatgacg
cagctggacgaaggcgggattctcgtcttacccgtaggggaggagcaccagtatttgaaa
cgggtgcgtcgtcggggaggcgaatttattatcgataccgtggaggccgtgcgctttgtc
cctttagtgaagggtgagctggcttaa

DBGET integrated database retrieval system