KEGG   Escherichia coli APEC O1 (APEC): APECO1_4196Help
Entry
APECO1_4196       CDS       T00425                                 

Definition
endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Brite
Enzymes [BR:ecv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     APECO1_4196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2595074..2595550)
Genome map
AA seq 158 aa AA seqDB search
MVEINNQRKAFLDMLAWSEGTDNGRQKTRNHGYDVIVGGELFTDYSDHPRKLVTLNPKLK
STAAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGALPMIDRGDIRQAIDRC
SNIWASLPGAGYGQFEHKADNLIAKFKEAGGTVREIEV
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaatcaataatcaacgtaaggcgttcctcgatatgctggcgtggtcagaggga
actgataacggacggcagaaaaccagaaatcatggttatgacgtcattgtaggcggagag
ctatttactgattactccgatcaccctcgcaagcttgtcacgctaaacccaaaactcaaa
tcaacagccgccggacgctaccagcttctttcccgttggtgggatgcctaccgtaagcag
cttggtctgaaagacttctctccgaaaagtcaggacgctgtggcattgcagcagattaaa
gagcgtggcgctttaccgatgattgaccgcggtgatattcgtcaggcaatcgaccgttgc
agcaatatctgggcttcactgccgggcgctggttatggtcagttcgagcataaggctgac
aacctgattgcaaaattcaaagaggctggcggaacggtcagagagattgaggtatga

DBGET integrated database retrieval system