KEGG   Escherichia coli APEC O1 (APEC): APECO1_421Help
Entry
APECO1_421        CDS       T00425                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00260  Glycine, serine and threonine metabolism
ecv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ecv01100  Metabolic pathways
ecv01110  Biosynthesis of secondary metabolites
ecv01130  Biosynthesis of antibiotics
ecv01230  Biosynthesis of amino acids
Module
ecv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APECO1_421 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APECO1_421 (trpA)
Enzymes [BR:ecv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     APECO1_421 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABJ00720
UniProt: A1AAN0
Structure
PDB: 

Jmol
Position
complement(1375275..1376081)
Genome map
AA seq 268 aa AA seqDB search
MERYESLFTQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEVLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAECEK
VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLAALKAFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctgtttacccagttgaaggagcgcaaagaaggcgcattcgtt
cctttcgtcaccctcggtgatccgggcattgagcagtcgttgaaaattatcgatacgcta
attgaagccggtgctgacgcgctggagttaggcatccccttctccgacccactggcggat
ggcccgacgattcaaaacgccacactgcgtgcttttgcggcgggagtaaccccggcgcag
tgctttgaggtgctggcactcattcgccagaagcacccgaccattcccatcggccttttg
atgtatgccaacctggtgtttaacaaaggcattgatgagttttatgccgagtgcgagaaa
gtcggcgtcgattcggtgctggttgccgatgtgcccgtggaagagtccgcgcccttccgc
caggccgcgttgcgtcataatgtcgcacctatctttatttgcccgcctaatgccgacgat
gatttgctgcgccagatagcctcttacggtcgtggttacacctatttgctgtcgcgagcg
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggttgcgaagctg
aaagagtacaacgctgcgcctccattgcagggatttggtatttccgccccggatcaggta
aaagcagcgattgatgcaggagctgcgggcgcgatttctggttcggccatcgttaaaatc
atcgagcaacatattaatgagccagagaaaatgctggcggcactgaaagcttttgtacaa
ccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system