KEGG   Escherichia coli APEC O1 (APEC): APECO1_423Help
Entry
APECO1_423        CDS       T00425                                 

Gene name
trpC
Definition
(GenBank) anthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ecv01100  Metabolic pathways
ecv01110  Biosynthesis of secondary metabolites
ecv01130  Biosynthesis of antibiotics
ecv01230  Biosynthesis of amino acids
Module
ecv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APECO1_423 (trpC)
Enzymes [BR:ecv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     APECO1_423 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     APECO1_423 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABJ00722
UniProt: A0A0H2YYJ7
Structure
PDB: 

Jmol
Position
complement(1377286..1378644)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEIQPSTRHFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIATVYRNYASAISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLAAVAHSLEMGVLTEVSNEEELERAIALGAKV
VGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFANGFLIGSALM
AHDDLNAAVRRVLLGENKVCGLTRPQDARAAYDAGAIYGGLIFVTTSPRCVSVEQAQEVM
AAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEDQLYIDTLREALPAHVAIWKALS
VGETLPARDFQHIDKYVFDNGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQTG
CAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaagcccgcaaa
cagcagcaaccgctggccagttttcagaatgagattcagccgagcacgcgacatttttat
gatgcgctacagggtgcacgcacggcgtttattctggagtgcaaaaaagcgtcgccgtca
aaaggcgtgatccgtgatgatttcgatccggcacgcattgcaaccgtttacagaaattat
gcttcggcaatttcggtgctgactgatgagaaatattttcagggaagctttgatttcctc
cccatcgtcagccaaatcgccccacagccgattttatgtaaagactttattatcgaccct
taccagatctatctggcgcgctattaccaggccgatgcctgcttattaatgctttcagta
ctggatgatgaacaatatcgccagcttgccgccgtcgcccacagtctggagatgggtgtg
ctgaccgaagtcagtaatgaagaggaactggagcgcgccattgcattgggggcaaaggtc
gttggcatcaacaaccgcgatctgcgcgatttgtcgattgatctcaaccgtacccgcgag
cttgcgccgaaactggggcacaatgtgacggtaatcagcgaatccggcatcaatacttac
gctcaggtgcgcgagttaagccacttcgctaacggttttctgattggttcggcgttgatg
gcccatgacgatttgaacgccgccgtgcgccgggtgttgctgggtgagaataaagtgtgt
ggcctgactcgcccacaagatgccagagccgcttatgacgctggtgctatatacggtgga
ttaatatttgttacaacgtcaccgcgttgcgtcagcgttgaacaggcgcaggaagtgatg
gctgcggcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtggtg
gacaaagctaaggtgttatcgctggcggcagtgcaactgcatggtaatgaagatcagctg
tatatcgacactctgcgtgaggctctgccagcacacgtcgccatctggaaggctttaagt
gtcggtgaaactcttcccgcgcgcgattttcagcacatcgataaatatgtattcgacaac
ggtcagggcgggagcggacaacgtttcgactggtcactattaaatggtcaatcgcttggc
aacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaaccggc
tgcgccgggcttgattttaattctgctgtagagtcgcaaccgggtatcaaagacgcacgt
cttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system