KEGG   Escherichia coli APEC O1 (APEC): APECO1_462Help
Entry
APECO1_462        CDS       T00425                                 

Gene name
ycjM
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    APECO1_462 (ycjM)
Enzymes [BR:ecv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     APECO1_462 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1427419..1429125
Genome map
AA seq 568 aa AA seqDB search
MGPLPRKGNMKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVL
ITYADQFHSNDLKPLPTFNQFYPQWLQRIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAG
EWQDIQQLGECSHLMFDFVCNHMSAKSEWFKNYLQQQPGFEDFFIAVDPKTDLSAVTRPR
ALPLLTPFQMRDHSMRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLEKGAEYVRLDAV
GFMWKEPGTNCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGEGDDEAH
MVYQFSLPPLVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPE
NEILALVEVLQQEGALVNWKNNPDGTRSPYEMNVTYMDALSRRECSDEERCARFILAHAI
LLSFPGVPAIYIQSILGSRNDYAGVEKLGYNRAINRKKYSSKEITTELNNKATLSYSVYY
KLSHLITLRRSHKEFHPDNNFTIDAINSFVMRIQRSNADGDCLTGLFNVSENIQHINITD
LHGRDLISEVDILGNEITLHPWQVMWIK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgctaccacggaaaggcaacatgaaacagaaaattacggattacctggacgaa
atctacggtggaacatttaccgcgactcatttacagaaacttgtaacgcgtcttgagagt
gcgaaacgattaattacacagcgacgtaaaaaacactgggatgaaagtgatgtcgtgtta
attacctatgccgatcaatttcacagtaatgatttaaagccactacccacatttaatcag
ttttaccctcaatggctgcaaagaattttttcacatgttcatttattacctttttatcca
tggtcatctgatgatggattttcggtaattgattatcatcaggtcgccagtgaagcgggg
gagtggcaggatattcagcaactcggtgaatgcagccatttaatgtttgattttgtctgc
aaccatatgtcggcaaaaagtgaatggtttaaaaactatttacaacagcagccaggtttt
gaagatttttttattgccgttgatccgaaaaccgatctcagcgccgtcactcgcccgcgt
gcgttaccgttattaacgccattccagatgcgcgatcattcaatgcgccatttatggacc
acctttagcgacgatcaaattgacctcaattaccgtagccctgaagtgttgctggcgatg
gtggatgtattgctgtgctacctggaaaagggcgcagagtatgtccgtctggatgccgtt
ggctttatgtggaaagagccgggaacaaactgcatccatctggaaaaaacacatctgatt
atcaaactgttacggtcgattattgataacgtcgcgccaggcacagtgatcattaccgag
accaatgttccgcataaagacaacattgcttactttggcgaaggcgatgacgaagcgcat
atggtgtaccagttctcgctgccgccgctggtgctgcatgcggtgcaaaaacagaacgtt
gaggcactttgtgcgtgggcgcaaaacctgacactaccttccagcaacaccacctggttt
aacttccttgcctctcacgatggcatcgggcttaacccactgcgggggttgttgcccgaa
aacgaaatattagcgctggtcgaggtgttacagcaggaaggagcattagtaaactggaaa
aataatcccgacggtacgcgtagcccctatgaaatgaatgtcacctatatggatgcgttg
agccgccgtgagtgtagcgacgaagaacggtgtgccaggtttattctcgcccatgcgatt
ttgttaagtttccccggtgtgccagcgatatatattcaaagcattctggggtcgcgtaat
gattacgcaggtgtcgaaaaacttggatataatcgtgcgattaaccgtaaaaaatactct
agtaaagagataacgacagaactgaacaataaagcgacattaagttattcggtatattat
aagttgtcgcatttaattacacttcgtcgcagtcataaagagtttcatccggataataat
ttcaccattgatgcgattaattcatttgtaatgcgaattcaaagaagcaatgcggatggc
gattgcctgacgggattgtttaatgtcagtgaaaatattcagcatataaatattactgac
ctgcacggtcgggatctgattagtgaagttgatatattgggtaatgaaataacactgcat
ccctggcaggttatgtggattaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system