KEGG   Escherichia coli APEC O1 (APEC): APECO1_614Help
Entry
APECO1_614        CDS       T00425                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase, propanol-preferring
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00010  Glycolysis / Gluconeogenesis
ecv00071  Fatty acid degradation
ecv00350  Tyrosine metabolism
ecv00625  Chloroalkane and chloroalkene degradation
ecv00626  Naphthalene degradation
ecv01100  Metabolic pathways
ecv01110  Biosynthesis of secondary metabolites
ecv01120  Microbial metabolism in diverse environments
ecv01130  Biosynthesis of antibiotics
ecv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APECO1_614 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    APECO1_614 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    APECO1_614 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    APECO1_614 (adhP)
   00626 Naphthalene degradation
    APECO1_614 (adhP)
Enzymes [BR:ecv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     APECO1_614 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 TrkA_N Methyltransf_31 Phage_holin_2_1 GFA DUF2284
Motif
Other DBs
NCBI-ProteinID: ABJ00914
UniProt: A0A0H2YYZ7
Structure
PDB: 

Jmol
Position
complement(1608658..1609698)
Genome map
AA seq 346 aa AA seqDB search
MQNIIRKGGTMKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGD
KTGVILGHEGIGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAG
YSVDGGMAEECIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGL
GGLGNLALQYAKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAARIVQEKAGGAH
AAVVTAVAKAAFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDL
TEAFQFAAEGKVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacatcatccgaaaaggaggaactatgaaggctgcagttgttacgaaggatcat
catgttgacgttacggataaaacactgcgctcactgaaacatggcgaagccctgctgaaa
atggagtgttgtggtgtatgtcataccgatcttcatgttaagaatggcgattttggtgac
aaaaccggcgtgattctgggacacgaaggtattggtgtggtggcagaagttggccctggt
gttacttcattaaaaccaggcgatcgtgccagcgtggcgtggttctatgaaggatgcggt
cattgcgaatactgtaacagtggtaacgaaacgctctgccgttcagttaaaaatgccgga
tacagcgttgatggcgggatggcggaagagtgcatcgtggtcgccgattacgcggtaaaa
gtgccagatggtctggactcggcggcggccagcagcattacctgtgcgggggtcactacc
tacaaagccgttaagctgtcaaaaattcgtccaggacagtggattgctatctacggtctt
ggcggtctgggtaacctcgccctgcaatacgcgaagaatgtctttaacgccaaagtgatc
gccattgatgtcaatgatgaacagttaaaactggcaaccgaaatgggtgcagatttagcg
attaactcacgcaccgaagacgccgccagaattgtgcaggagaaagccggtggcgctcac
gcagcggtggtgacagcggtagctaaagctgcgtttaactcggcggtggatgctgtccgt
gcaggtggtcgtgtcgtggctgtcggtctgccgccggagtctatgagcctggacatccca
cggctggtgctggatggtattgaagtggtcggttcgctggtcggcacgcgtcaggatcta
accgaagccttccagtttgccgccgaaggcaaagtggtgccgaaagtcgccctgcgtccg
ttagcggacatcaacaccatatttaccgagatggaagaaggcaaaatccgtggccgtatg
gtgattgatttccgtcgctaa

DBGET integrated database retrieval system