KEGG   Escherichia coli APEC O1 (APEC): APECO1_785Help
Entry
APECO1_785        CDS       T00425                                 

Gene name
btuE
Definition
(GenBank) vitamin B12 transport protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00480  Glutathione metabolism
ecv00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    APECO1_785 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    APECO1_785 (btuE)
Enzymes [BR:ecv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     APECO1_785 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin
Motif
Other DBs
NCBI-ProteinID: ABJ01086
UniProt: A0A0H2YZL4
Position
complement(1810372..1810923)
Genome map
AA seq 183 aa AA seqDB search
MQDSILTTVVKDIDGKVTTLEKYAGNVLLIVNVASKCGLTPQYEQLENIQKAWADRGFVV
LGFPCNQFLEQEPGSDEEIKTYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVA
PEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGLVIQRFSPDMTPEDPIVMESIKLA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattccattctgacgaccgtagtgaaagatattgacggtaaagtgaccacgctg
gagaagtacgccggtaatgtgctgttgattgtcaatgtcgcctcaaagtgtggcttaacg
ccgcaatatgagcagttggagaatattcagaaagcctgggctgatcgtggttttgtggtg
ctgggattcccgtgtaaccagtttctggagcaagaaccgggtagcgatgaagagattaaa
acttattgcaccaccacatggggggtgacgttcccgatgttcagtaagattgaagttaat
ggcgaaggacgtcatccgctgtatcaaaaattgattgccgcagcgccgactgcagtcgcg
ccggaagagagcggattctatgcccgaatggtcagcaaaggtcgtgcaccgctgtaccct
gatgatattttatggaattttgagaaatttttagttggcagggacggattggtcatccag
cgtttttccccggatatgacgccggaagatcccattgtgatggaaagcattaaactggcg
ttggcaaaataa

DBGET integrated database retrieval system