KEGG   Escherichia coli APEC O1 (APEC): APECO1_793Help
Entry
APECO1_793        CDS       T00425                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase II
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00010  Glycolysis / Gluconeogenesis
ecv00030  Pentose phosphate pathway
ecv00051  Fructose and mannose metabolism
ecv00052  Galactose metabolism
ecv00680  Methane metabolism
ecv01100  Metabolic pathways
ecv01110  Biosynthesis of secondary metabolites
ecv01120  Microbial metabolism in diverse environments
ecv01130  Biosynthesis of antibiotics
ecv01200  Carbon metabolism
ecv01230  Biosynthesis of amino acids
Module
ecv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APECO1_793 (pfkB)
   00030 Pentose phosphate pathway
    APECO1_793 (pfkB)
   00051 Fructose and mannose metabolism
    APECO1_793 (pfkB)
   00052 Galactose metabolism
    APECO1_793 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    APECO1_793 (pfkB)
Enzymes [BR:ecv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     APECO1_793 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: ABJ01095
UniProt: A0A0H2YZE8
Structure
PDB: 

Jmol
Position
1822308..1823240
Genome map
AA seq 310 aa AA seqDB search
MMVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIF
PAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFR
QLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIIDSSGEALSAALAIG
NIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCI
QVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDD
TQKIYAYLSR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatggtacgtatctatacgttgacacttgcgccctcactcgatagcgcaacaattacc
ccgcaaatttatcccgaaggaaaactgcgctgtaccgcaccggtattcgaacccggaggc
ggcggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttc
ccggcgggtggtgcgaccggcgaacatctggtttcactgttggcagatgaaaatgtcccc
gtcgctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagca
agcggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgc
cagcttgaagagcaagttctggaaattgaatccggggccattctggtcataagcggaagc
ctgccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaa
gggatccgctgcatcatcgacagttctggcgaagcgttaagtgcagcactggcgattggt
aacatcgagttggttaagcctaaccaaaaagaactcagtgcgctggtgaatcgcgaactc
acccagccagacgatgtccgcaaagccgcgcaggaaattgttaatagcggcaaggccaaa
cgggttgtcgtttccctgggtccacaaggggcgttgggcgttgatagtgaaaactgcatt
caggtggtgccaccaccggtaaaaagccagagtaccgttggcgctggtgacagcatggtc
ggcgcgatgacactgaaactggcagaaaatgcctctcttgaagagatggtccgttttggc
gtagctgcggggagtgcagccacactcaatcagggaacacgcctgtgctcccatgacgat
acgcaaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system