KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_837Help
Entry
APECO1_837        CDS       T00425                                 

Gene name
ydjB
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ecv00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1865342..1866001
Genome map
AA seq 219 aa AA seqDB search
MIKETAMPPRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGEAVIASQDWH
PANHGSFASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLKQKAIAAVFHKGEN
PLVDSYSAFFDNGRRQKTALDDWLRAHVINELIVMGLATDYCVKFTVLDALQLGYKVNVI
TDGCRGVNIQPQDSAHAFMEMSAAGATLYTLADWEETQE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggagactgcaatgccccctcgcgccctgttactggtcgatttacaaaatgat
ttctgtgctggtggcgcgctcgccgtgccggaaggtgacagtacggtggatgtcgctaac
cgcctgattgactggtgccagtcgcgcggtgaagcggttatcgccagtcaggactggcac
ccggcgaatcacggcagttttgccagtcagcacggtgtagagccttatacgccgggccaa
ctcgacggtttgccacaaaccttctggcccgatcactgtgtgcagaacagtgaaggcgca
caattacatccgttactgaagcaaaaagcgatcgcagcggtgttccataaaggcgaaaat
cctttagttgacagttacagtgccttttttgataacggccgtcggcagaaaactgcgctc
gatgactggttgcgcgctcatgtaatcaatgaattgatcgttatgggtctggctactgac
tattgcgttaagtttaccgtgctggacgcgttacagttaggttataaggtgaacgtgatt
accgatggttgtcgtggcgtgaatatccagccacaggacagtgcgcacgcgtttatggag
atgtcagcagctggggcaacgctatatacgctggcagactgggaagaaacgcaggagtaa

DBGET integrated database retrieval system