KEGG   Escherichia coli APEC O1 (APEC): APECO1_848Help
Entry
APECO1_848        CDS       T00425                                 

Gene name
yeaD
Definition
(GenBank) conserved hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00010  Glycolysis / Gluconeogenesis
ecv01100  Metabolic pathways
ecv01110  Biosynthesis of secondary metabolites
ecv01120  Microbial metabolism in diverse environments
ecv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ecv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APECO1_848 (yeaD)
Enzymes [BR:ecv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     APECO1_848 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABJ01149
UniProt: A0A0H2YZK2
Position
1877302..1878207
Genome map
AA seq 301 aa AA seqDB search
MKLKDCVMIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPA
GEEEVLWLSNNTPFKNGVAIRGGIPVCWPWFGPAAQQGLPAHGFARNLPWALKSHREDAD
GVALTFELTQSEETKKFWPHDFTLLAHFHVGKTCEIDLEAHGEFETTSALHTYFNVGDIA
KVSVSGLGDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGH
QHHLNVVGWNPGPALSVSMGDMPDDGYKTFVCVETAYASETQKVTKEKPAHLAQSIRVAK
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaggactgcgtcatgattaagaaaatttttgcccttccggtcatcgaacaa
atctcccctgtcctctcccgtcgtaaactggatgaactggacctcattgtggtcgatcat
ccccaggtaaaagcctcttttgcattacagggcgcacaccttctctcgtggaaacctgcg
ggtgaagaagaagttctgtggttgagtaacaacacaccgttcaaaaatggcgtcgccatt
cgcggtggcataccggtttgctggccgtggtttggtccggctgcacaacaaggtctgcct
gcgcacggttttgcccgcaacctgccgtgggcgctgaaatcacatcgtgaagatgctgat
ggcgtagcgctgacttttgaattgacacaaagcgaagagacgaaaaaattctggccgcac
gactttacgctgttagcgcatttccacgtgggtaaaacctgtgaaatcgatcttgaagca
cacggcgaatttgaaactacctctgctctgcatacctactttaacgtgggtgatatcgct
aaggtaagcgtcagtggactaggcgatcgcttcattgataaagtaaatgacgcgaaagaa
gatgtactgaccgacggtattcagaccttccctgaccgtaccgatcgcgtgtatctgaat
ccgcaagattgcagcgtaattaatgacgaagcgctgaatcgtattatcgccgtaggccac
cagcatcatctgaacgttgtaggctggaacccaggaccggcgctttcagttagcatgggc
gatatgccggatgatggctacaagacctttgtttgtgtagaaacggcttacgcttcagaa
acgcaaaaagtcaccaaagagaaacctgcacatctggcgcaatccattcgcgttgcgaaa
cgttaa

DBGET integrated database retrieval system