KEGG   Escherichia coli O1 K1 H7 (APEC): APECO1_960Help
Entry
APECO1_960        CDS       T00425                                 

Gene name
yedO
Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
ecv  Escherichia coli O1:K1:H7 (APEC)
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ecv00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2003467..2004549)
Genome map
AA seq 360 aa AA seqDB search
MTKKGAFTSAFFIYAFSACIIRKSQQHTSEAVMPLHNLTRFPRLEFIGAPTPLEYLPRFS
DYLGREIFIKRDDVTPMAMGGNKLRKLEFLAADALREGADTLITAGAIQSNHVRQTAAVA
AKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPNTQLEELATRVEA
QGFRPYVIPVGGSNALGALGYVESALEIAQQCEGAVNISSVVVASGSAGTHAGLAVGLEH
LMPESELIGVTVSRSVADQLPKVVNLQQAIAKELELTASAEILLWDDYFAPGYGVPNDEG
MEAVKLLARLEGILLDPVYTGKAMAGLIDGISQKRFKDEGPILFIHTGGAPALFAYHPHV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaagggcgctttcactagcgccttttttatttacgcgttttcagcgtgcata
ataagaaaatcacaacaacacacatcggaggctgttatgccactgcataatttaacccgt
tttccacggctggagtttatcggcgcgccaacgccgctcgaatatctgccgcgcttttct
gattatcttggacgggaaattttcatcaaacgggatgacgtcactcccatggcaatgggc
ggcaataaattacgtaagctggaatttctcgcggcagatgctctgcgtgaaggtgccgat
acgctgattactgccggggcgatccagtctaaccatgtgcgccagactgccgcagtcgct
gcgaaactcggtctgcattgcgtggcgctgctggaaaatcctattggtacaaccgcggaa
aactatttaaccaacggcaatcgtttgttgctggatctgttcaatacccagattgaaatg
tgcgacgcactgaccgatcccaatacccaactggaagagctggcgacgcgagtcgaagca
caaggctttcgcccgtatgtcattccggttggcggttctaatgctttgggcgcgctgggt
tatgtggagagtgcgctggaaatcgcgcaacagtgtgaaggggcagttaatatttcgtcg
gtggtggtcgcatcgggcagtgccggaactcacgccggactggctgttgggctggaacac
ctgatgcctgaaagcgaactgattggcgtgactgtgtcgcgttctgttgccgatcaattg
ccgaaagtggttaacctccaacaggcgattgcgaaagaactggagctgaccgcatcagcg
gaaattttactctgggatgactattttgcacctggctacggcgtgccgaacgacgaaggc
atggaagcagtgaaattgctggcgcggctggaaggcattctgcttgatcctgtgtatacc
ggaaaagcgatggcggggctgattgacggtatcagtcagaaacgcttcaaagatgaaggg
ccgattctgtttattcataccggcggtgcgcctgcgctgttcgcctatcatccccacgtt
tag

DBGET integrated database retrieval system