KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_0146Help
Entry
EcE24377A_0146    CDS       T00590                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ecw00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(158719..159198)
Genome map
AA seq 159 aa AA seqDB search
MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILAVSSFYRTPPLGPQDQPDYLNAAVA
LETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELAFPDGETLREVLHTRAFDKLSKW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatattgccataggcagcaatctggcctctccgctggagcaggtcaat
gctgctctgaaagcattaggcgatatccctgaaagccacattcttgccgtttcttcgttt
taccgcaccccaccgctggggccgcaagatcaacccgattacctcaacgccgccgtggcg
cttgaaacttcgctcgccccggaagagttactcaaccatacacagcgcatagaactgcaa
cagggtcgtgttcgtaaagctgaacgctggggaccacgcacgctggatctcgatatcatg
ctgtttggtaatgaagtgataaataccgaacgcctgaccgttccgcactacgatatgaag
aatcgtggatttatgctgtggccgctgtttgagattgcaccggagctggcgtttcctgat
ggggagacgttgcgtgaagtcttacatacaagagcatttgacaaattaagcaaatggtaa

DBGET integrated database retrieval system