KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_0749Help
Entry
EcE24377A_0749    CDS       T00590                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00020  Citrate cycle (TCA cycle)
ecw00190  Oxidative phosphorylation
ecw00650  Butanoate metabolism
ecw01100  Metabolic pathways
ecw01110  Biosynthesis of secondary metabolites
ecw01120  Microbial metabolism in diverse environments
ecw01130  Biosynthesis of antibiotics
ecw01200  Carbon metabolism
Module
ecw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EcE24377A_0749 (sdhD)
   00650 Butanoate metabolism
    EcE24377A_0749 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    EcE24377A_0749 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABV18552
UniProt: A7ZJA3
Structure
PDB: 

Jmol
Position
775702..776049
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgccaccagt
ggcgaactgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgattcatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggcattgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system