KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_0827Help
Entry
EcE24377A_0827    CDS       T00590                                 

Definition
(GenBank) phage lysozyme
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Brite
Enzymes [BR:ecw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     EcE24377A_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_lysozyme
Motif
Other DBs
NCBI-ProteinID: ABV20594
UniProt: A7ZJH3
Structure
PDB: 

Jmol
Position
846819..847316
Genome map
AA seq 165 aa AA seqDB search
MPPSLRKAVAAAIGGGAIAIASVLITGPSGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
MLGKTYTKAECKALLNKDLATVARQINPYIKVDIPETMRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMARREIEREICLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatcattacgaaaagccgttgctgctgctattggtggcggagcaattgctata
gcatcagtgttaattactggcccaagtggtaacgatggtctggaaggtgtcagctacata
ccatacaaagatattgttggtgtatggactgtatgtcacgggcatacaggaaaagacatc
atgctcggtaaaacgtataccaaagcagaatgcaaagccctcctgaataaagaccttgcc
acggtcgccagacaaattaacccgtacatcaaagtcgatataccggaaacaatgcgcggc
gctctttactcattcgtttacaacgtgggtgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatgtgatcagctacgtcgctggacatat
gctggcggtaagcaatggaaaggtctcatggctcgtcgtgagattgagcgtgaaatctgt
ttgtggggtcagcaatga

DBGET integrated database retrieval system