KEGG   Escherichia coli E24377A (ETEC): EcE24377A_1519Help
Entry
EcE24377A_1519    CDS       T00590                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ecw  Escherichia coli E24377A (ETEC)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EcE24377A_1519
Enzymes [BR:ecw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     EcE24377A_1519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1501818..1503497
Genome map
AA seq 559 aa AA seqDB search
MKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVLITYADQFHS
NDLKPLPTFNQFYHQWLQSIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAGEWQDIQQLG
ECSHLMFDFVCNHMSAKSEWFKNYLQQHPGFEDFFIAVDPQTDLSAVTRPRALPLLTPFQ
MRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLAKGAEYVRLDAVGFMWKEPGT
SCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGAGDDEAHMVYQFSLPP
LVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPESEILELVEA
LQQEGALVNWKNNPDGTRSPYEINVTYMDALSRRESSDEERCARFILAHAILLSFPGVPA
IYIQSILGSRNDYAGVEKLGYNRAINRKKYHSKEITRELNDEATLRHAVYHELSRLITLR
RSHNEFHPDNNFTIDTINSSVMRIQRSNADGNCLTGLFNVSKNIQHVNITNLHGRDLISE
VDILGNEITLRPWQVMWIK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaattacggattacctggacgaaatctacggtggaacatttaccgcaact
catttacagaaacttgtaacgcgtcttgagagtgcgaaacgattaattacacagcgacgt
aaaaaacactgggatgaaagtgatgtcgtgttaattacctatgccgatcaatttcacagc
aatgatttaaaaccattacccacatttaatcagttttaccatcaatggctgcaaagcatt
ttttcacatgttcatttgttgccgttttatccatggtcatctgatgatggcttttcggta
attgattatcatcaggtcgccagtgaagcgggggagtggcaggatattcagcaactcggt
gaatgcagtcatttaatgtttgattttgtctgcaaccatatgtcggcaaaaagtgaatgg
tttaaaaactatttacaacagcatccaggttttgaagatttttttattgccgttgacccg
caaaccgatctcagcgccgtcactcgcccgcgtgcgttaccgttattaacgccattccag
atgcgcgatcattcaacgcgccatttatggaccacctttagtgacgatcaaattgacctg
aattaccgtagccctgaagtgttgctggcgatggtggatgttttactctgttaccttgcg
aaaggtgctgagtatgtccgcctggatgccgttggctttatgtggaaagagccgggaaca
agctgcatccatctggaaaaaacacatctgattatcaaactgttacggtcgattattgat
aacgttgcgccaggtacagtgatcattaccgagaccaatgttccgcataaagacaacatt
gcttactttggcgcaggcgatgacgaagcacatatggtgtaccagttctcgctgccgcca
ctggtgctgcatgcggtgcaaaaacagaacgttgaggcgctttgtgcgtgggcgcaaaac
ctgacactaccttccagcaacaccacctggtttaacttcctcgcctctcacgatggcatc
gggctaaacccgctacggggcttgttgcctgaaagcgaaatattagagctggtcgaggcg
ttacagcaggaaggtgcattagtaaactggaaaaataatcccgacggtacacgcagtccg
tatgaaataaatgtgacctatatggatgcgttaagccgccgtgagagtagcgatgaagaa
cgttgcgccaggtttattctcgcccatgcgattttgttaagtttccccggtgtgccagcg
atatatattcaaagtattcttggctcgcgtaatgattacgcaggtgtcgaaaaactcgga
tataaccgtgcgattaaccgtaaaaaatatcacagtaaagagataacccgagaactgaac
gatgaagctacattaaggcatgcggtatatcatgagttgtcgcgtttaattacacttcgt
cgcagccataacgagtttcatccggataataattttaccattgatacgattaattcatcc
gtaatgcgtattcaaagaagtaacgctgatggtaattgtctgactggattgtttaatgtc
agcaaaaatattcagcatgtaaatattactaatctgcatggtcgggatctgattagtgaa
gttgatatattgggtaatgaaataacgctgcgcccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system