KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_2004Help
Entry
EcE24377A_2004    CDS       T00590                                 

Definition
(GenBank) aldose 1-epimerase family protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00010  Glycolysis / Gluconeogenesis
ecw01100  Metabolic pathways
ecw01110  Biosynthesis of secondary metabolites
ecw01120  Microbial metabolism in diverse environments
ecw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcE24377A_2004
Enzymes [BR:ecw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     EcE24377A_2004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABV16530
UniProt: A7ZMQ0
Position
1989451..1990356
Genome map
AA seq 301 aa AA seqDB search
MKLKDCVMIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPA
GEEEVLWLSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHHEDAD
GVALTFELTQSEETKKFWPHDFTLLAHFRVGKTCEIDLESHGEFETTSALHTYFNVGDIA
KVSVSGLGDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGH
QHHLNVVGWNPGPALSVSMGDMPDDGYKTFVCVETAYASETQKVNKEKPAHLAQSIRVAK
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaggactgcgtcatgattaagaaaatttttgcccttccggtcatcgaacaa
atctcccctgtcctctcccgtcgtaaactggatgaactggacctcattgtggtcgatcat
ccccaggtaaaagcctcttttgcattacagggcgcacaccttctctcgtggaaacctgcg
ggcgaagaagaagttctgtggttgagcaacaacacaccgttcaaaaatggcgtcgctatt
cgcggtggcgtaccggtttgctggccgtggtttggtccggcggcacaacaaggtctgcct
gcgcacggttttgcccgcaacctgccgtggacgctgaaatcacatcatgaagatgctgat
ggcgtagcgctgacttttgaattgacacaaagcgaagagacgaaaaaattctggccgcac
gactttacgctgttagcgcatttccgcgtgggtaaaacctgtgaaatcgatcttgaatca
catggcgaatttgaaaccacctctgccctgcatacctactttaacgtgggtgacatcgct
aaggtaagcgtcagtgggctgggcgatcgcttcattgataaagtgaatgacgcgaaagaa
gatgtactgaccgacggtattcaaaccttccctgaccgtaccgatcgcgtgtatctgaat
ccgcaagattgcagcgtgattaatgatgaagcgctgaatcgtattatcgccgtaggccac
cagcatcatctgaacgttgtaggctggaatccgggaccggcgctttcagttagcatgggc
gacatgccggacgatggctacaagacctttgtttgtgtagaaacggcttacgcttcagaa
acgcaaaaagtcaacaaagagaaacctgcacatctggcgcaatccattcgcgttgcgaaa
cgttaa

DBGET integrated database retrieval system