KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_2064Help
Entry
EcE24377A_2064    CDS       T00590                                 

Gene name
yebU
Definition
rRNA (cytosine-C(5)-)-methyltransferase RsmF
Orthology
K11392  
16S rRNA (cytosine1407-C5)-methyltransferase [EC:2.1.1.178]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2047814..2049259
Genome map
AA seq 481 aa AA seqDB search
MLVAQHTVYFPDAFLTQMREAMPSTLSFDDFLAACQRPLRRSIRVNTLKISVADFLQLTA
PYGWTLTPIPWCEEGFWIERDNEDALPLGSTAEHLSGLFYIQEASSMLPVAALFADDNAP
QRVMDVAAAPGSKTTQIAARMNNEGAILANEFSASRVKVLHANISRCGISNVALTHFDGR
VFGAAVPEMFDAILLDAPCSGEGVVRKDPDALKNWSPESNQEIAATQRELIDSAFHALRP
GGTLVYSTCTLNQEENEAVCLWLKETYPDAVEFLPLGDLFPGANKALTEEGFLHVFPQIY
DCEGFFVARLRKTQAIPALPAPKYKVGNFPFSPVKDREAGQIRQAAASVGLNWDGNLRLW
QRDKELWLFPVGIEALIGKVRFSRLGIKLAETHNKGYRWQHEAVIALATPDNVNAFELTP
QEAEEWYRGRDVYPQAAPVADDVLVTFQHQPIGLAKRIGSRLKNSYPRELVRDGKLFTGN
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtggcccaacacaccgtttatttcccggacgcctttctgacacaaatgcgcgaa
gcgatgccttcgacgctctcatttgatgattttcttgccgcctgtcagcgcccgttgcgc
cgcagcattcgcgttaatacgctgaaaatctccgttgctgatttcctgcaattaaccgct
ccttatggctggacgcttacgccaattccgtggtgtgaagaaggtttctggattgaacgc
gacaatgaagatgcattgccattgggtagtaccgccgagcatttaagcggcctgttttat
attcaggaagccagttcaatgttgcccgttgccgccttgtttgctgacgataatgcacca
cagcgggtgatggatgtcgcagctgcgccaggctccaaaacgacgcaaattgccgcgcgg
atgaataacgaaggggcaatccttgccaatgagttttccgccagtcgggtaaaagtgtta
catgccaatatcagccgctgtggcatcagtaatgttgcgctcacacattttgatggccgc
gtgtttggtgcggcagtgccagaaatgttcgatgccattttgctggacgctccctgctct
ggcgaaggcgtggtgcgtaaagatcccgatgcgctaaaaaactggtcaccagaaagcaat
caggaaatcgcagctacacaacgggagcttatcgacagcgcctttcatgcattacgtcct
ggtggtacgctggtttactcgacctgtaccttaaaccaggaagaaaacgaagccgtttgc
ctgtggctgaaagagacttaccccgacgcagtagagtttttaccacttggcgatctcttc
cctggtgcaaacaaagcgctgaccgaagaaggctttttgcatgttttcccacaaatttac
gactgcgaaggcttcttcgttgctcgtctgcgtaaaactcaggcgatccccgccttaccc
gcccccaaatacaaagtcggtaatttcccgttcagcccggtgaaagatcgcgaagccgga
caaattcgtcaggcggctgcaagtgttggcttaaactgggatggaaacctgcgactctgg
caacgcgacaaagaactgtggttgttcccggtgggcattgaagccctgatcggtaaagtc
cgattttctcgcttggggattaaacttgccgaaacgcacaacaaaggttatcgctggcag
catgaagcagttattgcccttgccacccccgacaatgtgaacgcttttgaactgacaccg
caggaagcggaggagtggtatcgcgggcgcgatgtttacccgcaagccgcgccagtggcg
gatgacgtgttggttactttccagcatcaaccgattggtttagccaaacggattggttcg
cgattgaaaaacagctatccgcgtgaactggtgcgcgatgggaaactttttaccggtaac
gcctga

DBGET integrated database retrieval system