KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_2091Help
Entry
EcE24377A_2091    CDS       T00590                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EcE24377A_2091 (ruvA)
Enzymes [BR:ecw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EcE24377A_2091 (ruvA)
DNA repair and recombination proteins [BR:ecw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EcE24377A_2091 (ruvA)
    RecFOR pathway proteins
     EcE24377A_2091 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH Transposase_20 HHH_3 HHH_8 LcrG
Motif
Other DBs
NCBI-ProteinID: ABV21140
UniProt: A7ZMY5
Structure
PDB: 

Jmol
Position
complement(2072962..2073573)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPATDDAEQEAVAALVALGYKPQEASRM
VSKIARPDASSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcatcattgaaaaacaacccccgctggtgttaattgaa
gtgggcggcgtaggctatgaagtgcatatgccgatgacctgtttttatgaactccctgaa
gcgggtcaggaagcgatcgttttcacccactttgtggtgcgtgaagacgcgcaactgctg
tacggttttaacaataaacaagagcgcacattgttcaaagagttgatcaaaaccaacggc
gtcggcccgaagttggcgctggcgatcctctccggaatgtcagcgcagcagttcgttaat
gccgttgagcgtgaagaagtgggggcgctggtgaaactgccgggtattggcaaaaaaacc
gccgaacgcttgattgttgaaatgaaagaccgatttaaaggtttgcatggcgatctcttt
acgccagccgccgacctggtactcacatcacctgccagcccggcgaccgacgatgctgaa
caagaagcagttgccgcgctggtggcgctgggctataaaccacaagaggcaagccgcatg
gtgagcaaaatcgctcgccctgacgccagcagtgaaacattaattcgcgaagccctacgc
gccgcgttatga

DBGET integrated database retrieval system