KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_2311Help
Entry
EcE24377A_2311    CDS       T00590                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ecw01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ecw00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2273760..2275064
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDNVKTRGDEALREYSAKFDK
TTVTALKVSAEEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCGVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMARRVAEAVERQLAELPRAETARQ
ALNASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARELVDGITSASSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKEGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcggagcaacaacgccagctg
ttaatgcgcccggcgatctccgcttctgaaagcattacccgcaccgttaacgatattctc
gataacgtgaaaacgcgtggcgatgaggccctgcgggaatacagcgcgaagtttgataaa
accacggttaccgcgctgaaggtgtctgctgaggagatcgccgccgccagcgaacgcctg
agcgacgagctaaaacaggcgatggcggtggcagtaaaaaatattgaaaccttccacact
gcgcaaaaactaccgccggtagatgttgaaactcagccaggcgtgcgttgccagcaggtc
acgcgcccggtcgcttcagttgggttgtatattcctggcggctccgccccgctcttctca
acggtattaatgctggcaactccggcgcgtattgcgggctgtaaaaaagtggtgctgtgc
tcaccgccgccgattgccgatgagatcctttatgcggcgcagctgtgcggtgtacaggac
gtgtttaacgtcggcggcgcacaggccattgccgcactggcgtttggtactgaatctgtg
ccaaaagtggacaaaatcttcgggccaggcaacgcctttgtcaccgaggcaaaacgccag
gtaagccagcgtctggacggtgcggctatcgatatgcccgcaggcccgtcggaagtgctg
gtgattgccgacagcggcgctacgccagatttcgtggcttctgatttgctttctcaggct
gaacacggcccggactctcaggtgattttactgacgcccgatgctgatatggcgcgtcgc
gttgccgaagctgtcgaacgccagctggcagaactgccgcgtgccgaaaccgcacgtcag
gcactaaacgccagccgcctgatcgtgactaaagatttagcgcagtgcgtagagatctcc
aaccagtacggcccggagcacctgatcattcagacccgcaacgcccgcgaactggtcgat
ggcatcaccagcgccagttcggtatttcttggtgactggtcaccggaatcggcaggtgat
tacgcctccggcaccaaccacgttctaccgacttacggttacaccgccacctgttccagc
ctcgggctggcagatttccagaagcgcatgaccgtgcaggaactgtcgaaagaaggtttc
tccgcgctggcttcgaccattgaaacattagccgccgccgagcgcctgaccgcccacaaa
aatgccgttactttgcgtgttaacgcccttaaggagcaagcatga

DBGET integrated database retrieval system