KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_2329Help
Entry
EcE24377A_2329    CDS       T00590                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00521  Streptomycin biosynthesis
ecw00523  Polyketide sugar unit biosynthesis
ecw01130  Biosynthesis of antibiotics
Module
ecw_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    EcE24377A_2329 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EcE24377A_2329 (rfbC)
Enzymes [BR:ecw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     EcE24377A_2329 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABV19799
UniProt: A7ZNL0
Position
complement(2292512..2293060)
Genome map
AA seq 182 aa AA seqDB search
MNVIKTEIPDVLIFEPKVFGDERGFFFESFNQKVFEEAVGRKVEFVQDNHSKSCKGVLRG
LHYQLEPYAQGKLVRCVVGEVFDVAVDIRKSSPTFGKWVGVNLSAENKRQLWIPEGFAHG
FLVLSETAEFVYKTTNYYHPESDRGIRWDDEELSITWPRGNELNLSNKDQQHPSFQNCQC
FE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaattaaaactgaaattccagacgtactgatttttgaaccgaaagtttttggt
gatgagcgtggtttcttttttgagagctttaaccagaaggtttttgaggaagctgtaggc
cgcaaagttgaatttgtccaggataaccattcgaagtcttgtaaaggtgtcttacgcgga
ttgcattatcagttagaaccttatgcacaagggaaattggtgcgctgcgttgttggtgaa
gtttttgatgttgcggttgatattcgtaaatcgtcaccaacttttggcaaatgggttggg
gtgaatttatctgctgagaacaagcgccagttgtggatacctgaaggatttgcacatggt
tttttggtgctgagtgagactgcggagtttgtatataaaactacaaattattatcatccg
gaaagtgatagagggatccgatgggatgatgaggaattatctattacgtggcctagagga
aatgaactaaacttatcaaataaagatcagcaacatccgagctttcaaaactgtcagtgt
tttgaataa

DBGET integrated database retrieval system